SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121899513|gb|EAY04573.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121899513|gb|EAY04573.1|
Domain Number 1 Region: 89-290
Classification Level Classification E-value
Superfamily L domain-like 2.14e-22
Family Internalin LRR domain 0.017
Further Details:      
 
Domain Number 2 Region: 2-121
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.96e-21
Family Cap-Gly domain 0.0022
Further Details:      
 
Domain Number 3 Region: 369-443
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000668
Family Ubiquitin-related 0.02
Further Details:      
 
Weak hits

Sequence:  gi|121899513|gb|EAY04573.1|
Domain Number - Region: 343-378
Classification Level Classification E-value
Superfamily CI-2 family of serine protease inhibitors 0.0536
Family CI-2 family of serine protease inhibitors 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121899513|gb|EAY04573.1|
Sequence length 474
Comment CAP-Gly domain containing protein [Trichomonas vaginalis G3]
Sequence
MQRVRTTDNHCATIRWSGRLVDSKGGEDDWYGVEWDDPSRGKHNGEYKGQKLFDVTVPNS
GSFLRASSVKKGVKISEIIHEYSLVGGSLSLDSTNVDQVGEFDNFPETVKTVNVACSLVG
SFQFIWDLLKLGKNIECLTLGCLHFVDFPTTQDTYNLQEIVLNDTNIKEDQLEIFLKALP
NLKIIDISNTSIRNFKVLQTCKQLETIKLNNLEISSLSTVIDTIGDLPNVKNLFLNDNTI
TKIDFKEGKLLSLESLSLASNKIEDLFSLDALTNYKALTEIRVNRNPIQEIKGEVDVRML
TIARYPQITKLNGSSILDKERRDSEVFYLNHFANEVYQNGHEKHPRWEELVKKYGEPAVT
CIKKEAPKNVKVILEYDGQDQEESFMPSITVEKVIQVAQNMFELEDEELEIVLEYKEYRA
KLKYTEQSLADVGCIDGSILHIRKEGEADDLFNDRDLAKKFRNRSMQAYARGGF
Download sequence
Identical sequences A2ERX8
XP_001316796.1.43485 88141.m00116 5722.A2ERX8 gi|121899513|gb|EAY04573.1| gi|123461208|ref|XP_001316796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]