SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121903595|gb|EAY08559.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121903595|gb|EAY08559.1|
Domain Number 1 Region: 287-481
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-55
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 47-52,140-257
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000144
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121903595|gb|EAY08559.1|
Sequence length 496
Comment ankyrin repeat protein, putative [Trichomonas vaginalis G3]
Sequence
MATIEGKKLSYNEAVSQYKGYIDTFNSIFKLKTTSKDEIKQIFEQIKTNLIEPKIFTSKL
LILSITNLVPYNNRYFKSYWELFKLIYEKYPVKKHYSEIPEFFDYFIYKQYGSVLDQNHE
GLFDKCEPNKYLFEIHEKNTIYRAIMDDDIELFITFIEREDFDKQKLLTSEFYPPSNKGY
SYLELCCYHGAVGCFKLLRTKFNSEITEDCLNLSFLGANQEIMNECLKFQKPTEESMGMA
IMSHNIDFVFYLLNEHGIKIDLSQCSRAYNVEVFLAHLDSTNDINGCFNASPIFNLLPLT
EYLFSLGADIDTKGEYDDTALHLSAQYNCAEIAEFLISQGADLNANNRFNQSPIFECCFL
DSAETAQVLISHGAKLNLTDNIYGETSLHKAAGSNCVKVAKILLENGENANAKEKHGKTP
LHVAAEHNYTEIAELLLSHGADINAKDNEGKTPLKYADENNNETFADFLISHGAELEEGD
VRKRRKRSSKSKKCII
Download sequence
Identical sequences A2EFG5
5722.A2EFG5 XP_001320782.1.43485 86633.m00166 gi|121903595|gb|EAY08559.1| gi|123475207|ref|XP_001320782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]