SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121904128|gb|EAY09082.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121904128|gb|EAY09082.1|
Domain Number 1 Region: 1156-1268
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000112
Family Second domain of FERM 0.0064
Further Details:      
 
Domain Number 2 Region: 1922-2036
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000688
Family Second domain of FERM 0.0092
Further Details:      
 
Domain Number 3 Region: 359-472
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000192
Family Second domain of FERM 0.01
Further Details:      
 
Domain Number 4 Region: 1540-1653
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000418
Family Second domain of FERM 0.017
Further Details:      
 
Domain Number 5 Region: 742-855
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000476
Family Second domain of FERM 0.015
Further Details:      
 
Weak hits

Sequence:  gi|121904128|gb|EAY09082.1|
Domain Number - Region: 2297-2393
Classification Level Classification E-value
Superfamily TM1646-like 0.00209
Family TM1646-like 0.0054
Further Details:      
 
Domain Number - Region: 1269-1362
Classification Level Classification E-value
Superfamily PH domain-like 0.00344
Family Third domain of FERM 0.063
Further Details:      
 
Domain Number - Region: 3369-3471
Classification Level Classification E-value
Superfamily ARM repeat 0.00806
Family PBS lyase HEAT-like repeat 0.076
Further Details:      
 
Domain Number - Region: 2928-3037
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.00863
Family Chemotaxis phosphatase CheZ 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121904128|gb|EAY09082.1|
Sequence length 5481
Comment hypothetical protein TVAG_180570 [Trichomonas vaginalis G3]
Sequence
MSVIRIYTSAGLDDPNPKYSTYSAQYTGDQFLQLACFNHGIQYNNTYVVRYMSRYGYEAI
LNPQDTLEQQGLVDDMHLFITWASETRPLPNYQQQVVPQVDYASQQMNVPNLGIPTLPTG
NNYQQQSSYFNFELPQFESGILPQGVPQYEEMPAYDPSQVPEAETELDVRIRNVESFDTS
VFETQTQLGLHENDSETIQAYTYNGFQENSLMPVTYCKSYTFQQVVSAATESLGLKYEDY
SILLCFSDDDMRWFDHNKYLEDYSVFSGMKFCIFPSEFQIKVESTAFNTNQYIISITDTV
EAIVKKIAQVENIENPSDFTLFKEETKTKDGKTKKSLVPLSLFQDLPHQCAEFKSLVFKR
RFFIFSAADLVSQSSILIAFDDAFDEIRSNKRIYIQPDVAVELTAYAYVVDHPDVQLDDA
NPPETKKHRPYAYKSDKSFNKQVNDFLKKNHIPDANNAARLFIRLARTQPGFGVIRFSCF
YEIEKVENECQTIISPHDFLIYHEQQNKTYVRIPYHSIVNTTLEEDVVTVNYSLQRNVGN
VSIRSKHADEIHDVINSFHSIQRNLLLERARLRLEGKWRGPVSEMDRLKLDTYNGISDKE
PVPIEYDKSFTGKMVLQLAMKELRLPVEKIDDYGVLCTIHTQRKWLNSDVTVGQLGIFEG
SKLYILTNKAKISIKFGDTDEKLFLDLTAPCKDVVTDIFKQIKQPYVHGYALFVHKNNEM
EPLDYKYPIPEQTLHFSTLYLRRRFFMLSKDDFASAQLSKIGYNDSREYFLHAKCEATDK
ELMELTALSLLIEGKDDACVQAKDFALEKWLPTTFKCKSDFKKNFVKYFPTYPRKDKEIN
YIRAYLKILRDVPFFGAECQDVKYRIIDTKLKKKGKFLDGEFRYCPLLVYLMDSSGKQVY
KIPWTLVIRTKIMKEVIHFTFCDATHHTNKDSVVTLEIRTNDMQRFQTMVDGSLNIYQQM
LKERQRELARQRAETAQKLAGGWTDQYGVIHGPMIDLMISQDLAVYKKSKTTFWIDLSAN
GEELVGQMSKYFQIEQKPTQVYSVVIISPDGSFSWLGPKETLLDVNPTRKSHLVILNTTP
LMKITSASNISKTIKLDITQPLKGLLKQIAAKYGISNFLGYTLFTPNTERPEEKLPLELI
KSIPEQTYNFDDIVFKRRFYMISRADFLDNRALWQTYSDIVELVLSGSMDLTNEQVAELA
YYQLIAEKNEKLEAKNVPEDLNKYVPKGMKLARSMGKDIKGFCKTMPIEDPNDARRKYIA
LARSIETFGSEIYQVQYYDTVKGKTVLKDCLLYVTPYKIYTCDLQKKEKYMCFEYCNLLD
VNQVEDMLSLAHCTNNGERLYDLFKSPQAALIKQIITSYIHIGMEILNNAIAEGLDVEEV
ATCYRITVLANYVLADNRNVQQSIALDSRLNGKQVSQRVTKLMGLHPRGEYACMLNFTKQ
DHKWVLDSELIGNLRPYENIPMSVYNRYMKIKISMDGVNYTYPAIDVTKPIKDLIPRLAA
HFDIEMPIGYTIFKADTNKPLDLRYTVPEQESIFDSFIFRRYYYMNSKYDMQNDFVVIKM
AEDFKAAALSGQGILNESEMLELAVYDIFMHADNPDLVKKMEFTTLDGFLPVGMISKPQY
IAKLNNLLATTPAMTAGNAARTYIIQVQKLNGFDRQTYNAKLADPKGDLPVHLSISSTQL
KVNFDTASRETISVSMKHVLNVQAIQDELYVRIESDEGESTVLQFHTPDACPIENKIIQL
IKVVIPELKIRESIAKVSYYNTKEIPVEQGEIPLIFAGRFNERRPRVIRINPNRTAAQVC
DVLQKHFFVKDLGYKIGYFSADFSFRFLEDDVAVRNVITRPDIVLYYMKPQTESYIESAQ
NFITKHKIHVSDPINTICQTILSQLGLGVEDGYTLYTPDFTPLDLQFSLPYQTDMIWDMY
LRRRFYVFTHQFFENPLNITSLYEDCKLAIMSGAIPTSEDLAAYLGIYSVYAQIPNVSDF
NPYLEKFGASSILPVQFQNSEVAQKKVDTISHSIVPVNNPDAQAKYIAEVCQLRGFGAEY
HDIEFKNAFKDWRPGVLALSPFAMTIESGGKVFDSIDYVKIIQYYPDEEGNMVIRYYNDN
NFINFVMIRSPRVNQVFTYINTLSHFMNEYGHLLTIDEIRAILLKLQNNPGAGVENYGFT
EDFKPSMFNLDVTDQGLNIDNLSIDDLNLNFLENNADYSTYNVDSNQPANVEFDLVDAPA
TIMNLYVDPSQFWIASPQGHSVSRSKKAIEAIEKNLKGLIDDFNKLTPTEFNARLNAIDD
MLALINPDDLSEEFRNEYLKLKEAIKQLRDLGRMIEQSDQELYRYKDQIQDLINQALASM
PTLKSQIDKKIVELAKTSNKNLTPVSRALIALTEQQDNLTLALINDLEKLKGLGFDTRAL
IRNLENSADALTRLAANFTDSTDPRVLDQLVIPQLEQMDALIKSIADLVLTANLSDKDLD
ALIRDLTGGTTSISSSLASFSNASKAAQGDLNKTLLNNRKAANAAMLTLIKAKKEIDAQM
KMLPADMQKEAKELSDLLARAAIELALNPNSINAPLQALDMLKLLLNKIRTKKQPNLKKL
DKSVDGVISDLEAALRAVSFVNIIPANVDKVIDDAMIMIRRFEAINADEWQARDKQSFVT
SEKAVADLKADIDAIETHIAALRKNMVNGQAQRLLQVDLLKLANELPKFQTAVDLIYKNT
NDGSFPVIIERLITDLDATLYDIPPLEDLDRCQHIEKYHNAMTAVANIINQTNRVMGLEA
MKKNPMTLAKLDAILEKVADLYTALVKDRAELHEHPFDKEAINQALRDLEKTAQTMNLMK
LPAAEVTEITRNNELSDAITEAVKSVAAAVSSLKDAPIKLYRLPPTRDQINKLNQALADY
IQMMSNLKKQDAIANNKQNAEKVQKEIDYIKQKMAEQKQLKPYDTQQFYHLLEKMYNRIE
RMPQKLNGLPHVSGPSPSDISRTTLPPLRNLLKAVVPTAEQATKDIIACIEPTEALIKAL
EALKNDKDIKKDKKALEDLESWIKALKAGDNMLKAVPKTGNTLQSLKALLGQLISLNNDV
QSVPSNLRKTIDKDVMAKLLDVLGLANAKISQAVICVRNIPTKGSVNADINLFQRLDQDA
ELDQSIPEMVQQFNDLSGLIKSISSIPQLGNRPHTKHLIDEMAALLNQLSIDVNAAKVDE
KKLLPVLTNSKDRLQTVAGNSELVSSIVGVPKLPDITKNVSSNAQTIARLLEKPHFNAAT
HKEFTTLILPQLMKLIEALKGPGYTQNANLPALAPLKDLPPTSQAWYDDLKTAKPGQAQR
ICDDIHSKLNNLIGLVMDYPELNDLANAIFNILDTTGKYTSASQSAGFATQLYPKTRAVA
PEVLKQALDAVADFLSGNTTNVPPNVLAALEENIGAIADKAEMMQPFVKMAAQAIAPLLS
SGDPLIAARAALLLALTSDNPEVRAAALEELSVRDFVRTANALNNLATEADMVTGAFNEE
IEYRLAYLKYAIAIADTKLLVKCGSISAAIILLDPMHNVQQACRLLLQSAERAGLKDFDN
LGGANKEYEQWLYESDLALSNMFNGQIDSLLVNLETALSDDQKNLLPKTVNKFIREMVPP
LKRKDRLLTIKWSDMADESNKYLAFTKNILPAIKSSGVVSNGREMAIAISDTINKITPAI
RMWSAMANKIDEPKFRNQTEADIGNYLYNAPQLIQEATVPQQLALTEGRLETCLHDAIWA
HELAKFEPKTKDKVENIERLISSLKQNMSNSPMVTKQMLNMLVDKLKEMLNQIIKSYPID
FSKQVVDDSSRTIDFDLITDKDCLAAAKIIKTELDKSKKVADSTKHIKQEKRKDGVKNIP
KSVIDIQSNPTGAPGIAALENLNSETTQQFELQARLAELMQLLLQLYPDLIKFLDNPQQV
AAALMQMDEGDIQRTAGEINNMLGLIADPEKFDKYAKNLSQEQVFNELLLLRHMTDSLMN
QPVKNSYNTREIVNWIMKNPSSEADPARAFQKMSAVEQLLQTLMALKFSAGTNNPKAAKF
ARTEEGMNVLRQNIPQHDLIQIQQGIAQQMGFASLPESLKIIQSSMSPEEVLLQARVINL
AIDILTKNADKLNPENMTQNEVLKELFQQQLAQSKENPNTFGNNYVDQELTEAALTYIDD
TQAKLAVFRAISQLAGPMATVPPKPIESNMKKALDAATNQVNNPSNETPKLSNQEKDAAQ
YALSVVSSPEFLKFVPPRKETVASSDTTMISSMTNALTPASGTELYLAPASSGINNSFTK
NDMVHNALVAATLFNNIKKAINAAKPNVKPQMKAENRAQALEELENFKQTPLKDYSSKVQ
QLKPDEAAALLALVEGSLASLNDAVTKLNGAGYRDSIFDRACLLAMQQKGTPDPLTAQKI
QELQAIAAKRRKEVDLASKIGKLLINRSNVADCTPASTMSNNAKKQSVDEVIKQMEMTLS
ALSSQLERFNDDELSNQQAVLISAGLLQHEVSVDNIADLAKLAVEQPLQRGSTSRVINSI
KYEEQQQNLLEKLINIAKKINDIIKDAKAGSYSIQEYAQAQDTIATMLGISDEQLGDYIN
RCPKEQLVIIAGQIAEIIGMLNKVEKKAITDFPVAIPDYDLTIRAQNETPSTHQLATAEA
NLFAAILRLLPSMSMVPVSECKSILATETQSAGVILTRLLNHKGSSYPVDASTLLQVMPQ
LCAAAIRVVSTLPESARKLIGCTPTDLAIMSARVSTTAASLSDPKASQECYTAIEKLLTA
IRALNAICAERGIELKSVDALANVKRSIDTKDIDEITMSLIDTRALNAAAASSNTKDAPL
DAVKQQLADVEGPSFELQAKQSPVSAELGKKLESIKPKLIEVITRYSEDPLKEIASIQNI
RTARDSLLDKRARFQTGVNGFVRSVTRKDRKLVKNAITDILTTVSTGESMAARSLLVTNA
NNPGNYSDLVGKFAMSVSSLKSIDELGGDSSTNPTAVRRTTRSLNRMIDSLIDMLEDAET
PQWTEKPKSAIDLAKLEVLKALTSTIQVLMGAVAAHNSAKIPETFAVSLQKCMPQLTQSL
NDLAKRADEIEKPNTDKNAYIAFKGDVGTFTHSINDLTNNLNNISMSGLLSKLLEVASSS
RNTLTSLNRLTDVEIEEPDLEAAEMLPQHFTMPPVPSDINATLAEQAQQLTKLANAAIDQ
EKAFFTAAAAKDNKKTATAMVNYAKAMKAAVEQILRASATTTTLSNQNMLTTGASNIVNS
FESLLTALRNRFLLRGDWANTSAEAKQSLENELSTAIKVVNEAVEIARREEAMNDAVTKR
LRAALKPLQTAASKVDSQLQAAQERPSSMSREWALQVLSLGSALSKATIKIMLHSKEHPS
ANSNKHADLGENVIRQLAKISADVEKILAGADEPEGIVIGIMDALAGVCQNVQKGSGIED
QALLEAFNIVLKTSRNVKATAEGIQEQKKAAKARAAAGGGVTSSAKKQSKPQLLKRLDLE
SRVIRARTILERYEAQLNELQ
Download sequence
Identical sequences A2EE85
gi|121904128|gb|EAY09082.1| gi|123476263|ref|XP_001321305.1| 86412.m00159 5722.A2EE85 XP_001321305.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]