SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121912779|gb|EAY17597.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121912779|gb|EAY17597.1|
Domain Number 1 Region: 253-537
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.51e-101
Family Ankyrin repeat 0.0000206
Further Details:      
 
Domain Number 2 Region: 57-112,140-212
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000811
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121912779|gb|EAY17597.1|
Sequence length 539
Comment ankyrin repeat protein, putative [Trichomonas vaginalis G3]
Sequence
MIATELIDSKKYPPKNIIRDILNIIPYNNRYTKSYLYLAKLIYDNYHVKEVKSRRINIDI
LFYKEYGINSDKNGYFGEINSENLNIHADDTIYRAIMYNDLEKFIFFTEREEFDKDQKLM
SDLYPYEIKRYLSSYKGYSLLELCCYHGAVDCFKLLRTKFNSEITETCLKFSFLRGNPEI
MSECLKYKKPDYQCMEYAIISHNIDFVTFLINEYKIEIDLGYSGIYNNLESFLVYFDQTN
DINKCFVYSTLFDFPSLSEYFFSHGAEINTKFKYGETALHAAIYRNNKEMSDFLISHGAN
INEKDRDEQTAIHYSATNNNKEIAELLLSHGANINEKDKNGTTALHYAAKNNRKEIVELL
ISHGANVNEKEKNGRTALHYAAKNNRKEIVELLILQGADINEKDNLGKTALHYSATNNNK
EIAELLLSHGANINEKDGGEQTALHYAVYFNSKEISVLLISRGANINEKDNLGKTALHFA
AEYNCKETAELLISGGANINEKDNDEQTALHIAVSKDYKEISELLLSHGANINEKDIPG
Download sequence
Identical sequences A2DQ01
gi|121912779|gb|EAY17597.1| gi|123508829|ref|XP_001329732.1| 5722.A2DQ01 95940.m00208 XP_001329732.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]