SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121915794|gb|EAY20580.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|121915794|gb|EAY20580.1|
Domain Number - Region: 128-205
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0612
Family Calponin-homology domain, CH-domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121915794|gb|EAY20580.1|
Sequence length 356
Comment hypothetical protein TVAG_239570 [Trichomonas vaginalis G3]
Sequence
MKKSKAHFLWLLYTLSDKCNDTKAKELCQNLDAMDSQEFLGYFSDIKTYILLTNYIFDVN
TDAPIDILHNHGYYRYGDASIFAKSNFDEIAFINLIECYMWASLDRKIPTNVLVKKVGRT
KVFSLNDPEAIICSWINTCCSTYTKLRPVTSISQYFIGSNQFRALLYSYTRDESLLQYSD
PKTNAEISLRTCSTYGIKQTFEYENYQQSPLVIMCFLVDAIAKLDSIKPLPRPRTISRMD
MQRIEKNISDTKKEVESLKIRCGVLANDVNLIAARLVRMKRPSTSISAVKSKPQLPVQMQ
FPDGPGLPPLHDLQSDIPDDRPKSALHVKWEIPVEMLSNRGGGKLKDPQSSPVESL
Download sequence
Identical sequences A2DGI4
gi|121915794|gb|EAY20580.1| gi|154417090|ref|XP_001581566.1| XP_001581566.1.43485 5722.A2DGI4 88273.m00331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]