SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123508647|ref|XP_001329684.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123508647|ref|XP_001329684.1|
Domain Number 1 Region: 226-578
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.3e-90
Family Ankyrin repeat 0.00000913
Further Details:      
 
Domain Number 2 Region: 77-204
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000288
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123508647|ref|XP_001329684.1|
Sequence length 588
Comment ankyrin repeat protein [Trichomonas vaginalis G3]
Sequence
MIIEAVQMAAAFNNKYFRSYLKIFKKVYEEYHPAIYTPPSPAMLYFLYMDYGVLAFGITL
QTIQKLELKGFVLDVHPENTIYRAIMNDDIQSFIAFTERAGFDENQRFYNDFYEYSSRGY
TLLELCCYHGAVNCFKLLRTKFNSIISEKCLQMSFLGGNQEIMSECMKQVKPNKECMRYA
IMSHNNDFVSFLAEECNIEIVANECYLFYNLQALFILLDRTKDIGSCLVKSAYFNIPSLC
EYFLQHGANVNAMESDKFGMTAIHVATQFFNFETANFLLANGSDINIKSKIGLNPLHIAA
GKCGKEVLEFLISHGSDIKAKTREGNLAIHMAAISNQVKNTEYFLDHGFDINERNNEGVT
PLHIAVKYHSNDVADFLIQRGANINSKDLFDGTPLHFAARCKNREMVEVLVLLGADINAR
DNHQRTPLHCAGESTDTGAAEVLIAQGSDINAIDDVGFTVLHYAAEINCVKTAIFFISHG
ANVDAMAFANETPLIVAAAKNSTRVAEILILNGANINHKGIYGDNALHICAKYGSLNVAA
ILVKHGIDIKAKNFGGITPLEVAQRSRNFGMVIYLNMLYKAYGNLPNI
Download sequence
Identical sequences A2DPV3
XP_001329684.1.43485 gi|121912731|gb|EAY17549.1| gi|123508647|ref|XP_001329684.1| 95940.m00213 5722.A2DPV3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]