SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124507147|ref|XP_001352170.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124507147|ref|XP_001352170.1|
Domain Number 1 Region: 1608-1651
Classification Level Classification E-value
Superfamily EGF/Laminin 6.91e-16
Family Merozoite surface protein 1 (MSP-1) 0.00023
Further Details:      
 
Domain Number 2 Region: 1652-1701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000000293
Family Merozoite surface protein 1 (MSP-1) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124507147|ref|XP_001352170.1|
Sequence length 1720
Comment merozoite surface protein 1 precursor [Plasmodium falciparum 3D7]
Sequence
MKIIFFLCSFLFFIINTQCVTHESYQELVKKLEALEDAVLTGYSLFQKEKMVLNEEEITT
KGASAQSGASAQSGASAQSGASAQSGASAQSGASAQSGTSGPSGPSGTSPSSRSNTLPRS
NTSSGASPPADASDSDAKSYADLKHRVRNYLFTIKELKYPELFDLTNHMLTLCDNIHGFK
YLIDGYEEINELLYKLNFYFDLLRAKLNDVCANDYCQIPFNLKIRANELDVLKKLVFGYR
KPLDNIKDNVGKMEDYIKKNKTTIANINELIEGSKKTIDQNKNADNEEGKKKLYQAQYDL
SIYNKQLEEAHNLISVLEKRIDTLKKNENIKKLLDKINEIKNPPPANSGNTPNTLLDKNK
KIEEHEEKIKEIAKTIKFNIDSLFTDPLELEYYLREKNKKVDVTPKSQDPTKSVQIPKVP
YPNGIVYPLPLTDIHNSLAADNDKNSYGDLMNPHTKEKINEKIITDNKERKIFINNIKKK
IDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFNKDVVDKIFSARYTY
NVEKQRYNNKFSSSNNSVYNVQKLKKALSYLEDYSLRKGISEKDFNHYYTLKTGLEADIK
KLTEEIKSSENKILEKNFKGLTHSANGSLEVSDIVKLQVQKVLLIKKIEDLRKIELFLKN
AQLKDSIHVPNIYKPQNKPEPYYLIVLKKEVDKLKEFIPKVKDMLKKEQAVLSSITQPLV
AASETTEDGGHSTHTLSQSGETEVTEETEETEETVGHTTTVTITLPPTQPSPPKEVKVVE
NSIEHKSNDNSQALTKTVYLKKLDEFLTKSYICHKYILVSNSSMDQKLLEVYNLTPEEEN
ELKSCDPLDLLFNIQNNIPAMYSLYDSMNNDLQHLFFELYQKEMIYYLHKLKEENHIKKL
LEEQKQITGTSSTSSPGNTTVNTAQSATHSNSQNQQSNASSTNTQNGVAVSSGPAVVEES
HDPLTVLSISNDLKGIVSLLNLGNKTKVPNPLTISTTEMEKFYENILKNNDTYFNDDIKQ
FVKSNSKVITGLTETQKNALNDEIKKLKDTLQLSFDLYNKYKLKLDRLFNKKKELGQDKM
QIKKLTLLKEQLESKLNSLNNPHNVLQNFSVFFNKKKEAEIAETENTLENTKILLKHYKG
LVKYYNGESSPLKTLSEVSIQTEDNYANLEKFRVLSKIDGKLNDNLHLGKKKLSFLSSGL
HHLITELKEVIKNKNYTGNSPSENNKKVNEALKSYENFLPEAKVTTVVTPPQPDVTPSPL
SVRVSGSSGSTKEETQIPTSGSLLTELQQVVQLQNYDEEDDSLVVLPIFGESEDNDEYLD
QVVTGEAISVTMDNILSGFENEYDVIYLKPLAGVYRSLKKQIEKNIFTFNLNLNDILNSR
LKKRKYFLDVLESDLMQFKHISSNEYIIEDSFKLLNSEQKNTLLKSYKYIKESVENDIKF
AQEGISYYEKVLAKYKDDLESIKKVIKEEKEKFPSSPPTTPPSPAKTDEQKKESKFLPFL
TNIETLYNNLVNKIDDYLINLKAKINDCNVEKDEAHVKITKLSDLKAIDDKIDLFKNPYD
FEAIKKLINDDTKKDMLGKLLSTGLVQNFPNTIISKLIEGKFQDMLNISQHQCVKKQCPE
NSGCFRHLDEREECKCLLNYKQEGDKCVENPNPTCNENNGGCDADATCTEEDSGSSRKKI
TCECTKPDSYPLFDGIFCSSSNFLGISFLLILMLILYSFI
Download sequence
Identical sequences Q8I0U8 W7KFP9
gi|124507147|ref|XP_001352170.1| gi|23505200|emb|CAD51981.1| XP_001352170.1.26446 PFI1475w 5833.PFI1475w-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]