SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124507231|ref|XP_001352212.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124507231|ref|XP_001352212.1|
Domain Number 1 Region: 420-522
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000388
Family UBX domain 0.018
Further Details:      
 
Domain Number 2 Region: 231-362
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000962
Family Thioltransferase 0.025
Further Details:      
 
Weak hits

Sequence:  gi|124507231|ref|XP_001352212.1|
Domain Number - Region: 3-39
Classification Level Classification E-value
Superfamily UBA-like 0.000148
Family TAP-C domain-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124507231|ref|XP_001352212.1|
Sequence length 531
Comment UBX domain, putative [Plasmodium falciparum 3D7]
Sequence
MNEFIKLFMDITKEDDEKKASSFLESYNWNVEEAITRYFIATKQKTSTEDVTTSNENNEN
NQVLEKKNKKKEKKNKKKEKKNKKKEKNKKEESNKKEEKNNIHINDAAIRNEYLHKNDED
NKDISDFSSISSDEGNIEEGNTLNNYEINEEEHVGRTNFLYFLNHIGKMVFPIFKNLYNV
MSSFFKILSTYIISSTTTSTAASASESPSTSTSTSTSPSSSEPYTSSYDNGFTKYYENKY
SKVHTDFFRGSLKEAINKSRREEKLLLVYLHIEYDDVSYFCEHVFNNLEMKSFFDENCIL
YAHDISKGDIKELSTTLNVFMLPQISIILTCYVTDMMELSIIYGQPSITHIMNTISHCIE
KMDMKREKMEMLKNKNYRDRLIREEQDREYQEALRKDRLKEEEKKKKENEKLVKIQEKNK
IKNERKEKTKKFPLCISSNEQIAKICIRLPNGIRIQNNFGLSNTLQDIYEWAECSEFLQP
QNQKVIIPYKFQLICSLTKWNVQRTSEQIKNFDLYPNAIFNMKSLDTSDEE
Download sequence
Identical sequences A0A2I0BSA0 Q8I2H1
5833.PFI1680w-1 XP_001352212.1.26446 PFI1680w gi|124507231|ref|XP_001352212.1| gi|23505242|emb|CAD52022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]