SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124800702|ref|XP_001349538.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124800702|ref|XP_001349538.1|
Domain Number 1 Region: 1008-1184
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 7.45e-82
Family Gametocyte protein Pfg27 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124800702|ref|XP_001349538.1|
Sequence length 1192
Comment conserved Plasmodium protein [Plasmodium falciparum 3D7]
Sequence
MLKKYIILIYIGVILNFITKNNNVVSVPEPFLSQNKDSFEEKKYTYGDNLQLGASTINTP
KTQSQENKDINKETKNTIIKKTNNFPSTLNEKFPHKIQLTNKENKEDEQNKENKKDEQNK
EDEQNKQNKEDEQNKQNKDKKNIVSNKLSGNNEQQNNSIPKSIQKPENCVKKQSNQFPRS
YPEFFEANFGPIDELMDETDYSSDDLEDQLNYGYRGIEHDIDETDYYIGSILGYSDFMNK
MKYQNTQIDNNKGKKTTNTMEKNKKNRDKKHSKKRKTKQNYKYKKENQNIENHIPQSKYK
QERIEILDDNGKELKSHKNIKEEKGGIEKTDTTNIADIKIKKEERETKDEKEKNIQQLVK
DVQLIKVGEETKDDEKEDKEGTDDEEDTDDEEDTDDEEDTDDEEDTSDEETTGDQENKEE
TEVDEKKTEKAEEELEEDKEESEKDKEESEKDKEESEKDKEESEKDKEKTEEDEEKTEDE
KGTEVYKKETDVDEKKEKGEYGEGTDDEEDKEKEEDDEETKVEEKKTEKDEEGTDYEEDT
DDSDKDEETKVEEKKTERDEEETEEDEKETEVEKKKTEKDEEGTDYEEDTDDSDKDVETE
VEETDAEDKEENEEGTDDEEDKVEETDLDDQEEDGEEDKEDDKEKDKEDDKEDDKEKDKE
DDKEKYKEDDKEDDKEDDKEKDKEDNKEKDKEDNKEKDKEDDKEKDKEDDKEKDKEDNKE
KDKEDNKEKDKEDDKEKHDKHVRRIKKKMKDDDYDESLKTKNYYPHNMTFGQQQYFPYYN
PLEQQNYQLHHIIKQQQNYHPHHIIKQQQNHNPHHILQEQEKHHPQGIPKEQPYNNVPYI
LKKGLEPKTHNHVKEDQPNIKQGVVKGQEPHVDDMHNNTKEHKNFKNTTDVKQPASHIYN
NSSEKQIEHVYNKSPEKQIEHVYNKSPEKQIEHVYNNSPEKQIEHVYNNSPEKQIEHVYN
NSPEKQIEHVYNNSPEKPARHTNNISLEKQNSHKYNVNIQDRHDPVYYKYEDMLKRDKDL
FTIINNICELEFNSTNNYLMKIINNDKLKHNSLNDNEAILKEITKTQNELFSLKLPLEIK
VSMALRISERLRAFVFDKDLTAYYIKKLKDIFKLETEAAKNYYYYVKCQKTFSDKKRLVN
NLDSIKLYYESQINKNFISIPKDKIPTAIYRISNLVNDLIFLLPQSNANKAL
Download sequence
Identical sequences A0A2I0BUY4 O96127
gi|124800702|ref|XP_001349538.1| gi|3845099|gb|AAC71813.1| PFB0115w XP_001349538.1.26446 5833.PFB0115w-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]