SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146081198|ref|XP_001464193.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146081198|ref|XP_001464193.1|
Domain Number 1 Region: 443-549
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000108
Family Calponin-homology domain, CH-domain 0.0077
Further Details:      
 
Weak hits

Sequence:  gi|146081198|ref|XP_001464193.1|
Domain Number - Region: 326-395
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.0262
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146081198|ref|XP_001464193.1|
Sequence length 1029
Comment hypothetical protein [Leishmania infantum JPCM5]
Sequence
MSASRQASKVSATARATKFSAIRKLPTAKQSTSAVAAAHTSSDEPRRPALISFDVDATID
TVNSLHEEQHRVSEEDVTDKRIGRYHYAQLVARLNEQRSLYQSTAVFVETMLKEVNHSTE
ASVAMKASAATWGLKLLAKHAGYGAISTVLESLLPALYCEYSPEKLCRASPAVELQVRRP
DVLMDNPYFTHSMFVDEVQVDKRSATKLQKSLEAALRANDQRRSIVCHLIERQRQQQLEV
VFRCWRHHVRQQHLLRMMGDNTAKQWADEMSRLRVQAVFYHWKLLVERSRSTYLTERLHE
AAFQLENAKNQFQLQCYRADRLVRTAKEATEEMERVSQINEDLQRQVDELKEEQVRKERE
YKEKLTRNVTQVLKLLETYDALARVLLHSKQADEYFMPEKPLLARHSQSGDGGEEASENE
GQLLEVNAVAEASWESPSGSALQCLRQWCDGVLGQASGRTEPFKPIRSFGADFSNGERYL
YIFQHVFPEVVPTVLQIHDMDVESRLRRIRGYVADCGLRYRLVPSDLMNQREDLLVCSLS
ELYQQHLLRKWDQMVSRSMTELNALREGDMKEALLGCTASSSTEDVADVPAEQLDEAAVR
AHVSDYVERVKAMSEEFRTSLAVENEVVKASTAIAVQEARLGGERLQGTPIPLVDEAERC
AFWKLPAGALDDLRGAKKLNSEERMWNLIVTQTLPEVLQAHVDTTSRLFYLFAGENAKSL
SEVAFWRLVECSGILVGGMEVPMDWIARQYDHVVTPQLDAALRAVARNQSEMSVQKLRQV
AYQEMDIRSATPQQFVELLVRLAMASEKGKYGLVEGTRRLLQGLQLLNNEISPVARALHE
PEAQHVLRFFNEDLFRVYLFYVKKQESSRNTQDASMATQFGGRFASQMSITMLLTMLEDC
RFLLDGSGRRNSSIGVSADFTRPLFFINAAQVRKVVSALGSFCKGAMSGGLSFNLFVDTL
AVLAHHWCPDPLVPEPRRLAGFLAHTVQQLSARHINSTLLLGTVPSIRLEGPRNVDFSQE
ARPSVGTVA
Download sequence
Identical sequences A4HVV2
5671.LinJ14.0100 gi|146081198|ref|XP_001464193.1| XP_001464193.1.40037 psu|LinJ14_V3.0100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]