SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146093638|ref|XP_001466930.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146093638|ref|XP_001466930.1|
Domain Number 1 Region: 103-401
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-83
Family Protein kinases, catalytic subunit 0.00000207
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000155
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146093638|ref|XP_001466930.1|
Sequence length 510
Comment protein kinase [Leishmania infantum JPCM5]
Sequence
MSGYLKVLSPDGRWETRYVEIDDAKLRIWRTKGDKESSAAVVKELDLKCATLREVSEPNT
WAVQPEKAEATYFQADGEERKTEWMDTLRHYNSSSSASEKVTLRDFEKKFVLGKGSYGKV
FMVVKKDTDKWYAMKEMSAEKMRQAEIKAPFAERIILEEIDHPFIVHLHYSFQEQGNLYM
ILDLLAGGELFTYIEQHAPLDEEVVKFYAAEVALALGYLHSRNIIYRDLKPENVVFDRDG
HACLTDFGLAKANVHEPNAVTYCGTNEYLAPELLKGVPHGKAVDWWSLGLMMCEMLFNDL
PFYDENPMQMQMKILTEDVAFPPHIQITEETKDLIRCLLNKNPERRLQTLEAFKAHKCFS
NLDFGLLEARKLKAPITPDPNPAHNFAKEFTSEVIVQNESPSQAVVTLAGYTYDRDLSEQ
EKSPSHSPTIAEELRQRRASMKKSTNGSDAASPPVTGENRTSNSSPAGAPTKQAAAGPVK
KVEHHIPAKVAPQAARKKLTGNKSFDKPTK
Download sequence
Identical sequences A4I5B1
XP_001466930.1.40037 gi|146093638|ref|XP_001466930.1| psu|LinJ30_V3.0850 5671.LinJ30.1160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]