SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146094652|ref|XP_001467342.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146094652|ref|XP_001467342.1|
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.18e-30
Family Synaptotagmin-like (S variant) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146094652|ref|XP_001467342.1|
Sequence length 288
Comment c2 domain protein [Leishmania infantum JPCM5]
Sequence
MGRLEIRVCGARNVANVQKVGKPDPYVKVKLGSNKKSQIKYKTHVAENCLNPVWNELFKF
QVADYDSMQVVFELWNDNVIVDDLLGSYSLSLNGLTRGVVVDTWVLLEGTKGSPSELHLR
VLAVDFGRDPGPGDRLTLSLEGDTMVPSTGQTYRPPKNYVPPAQGIVLQSYPPAPLGPPP
PVVYSASAAPMPQVQYGYMAPPQPQGYAYGAPPPPPQQPPSQGYGYGAAPAPQNYSYGAP
PPPQPMYGAPQPPQSLPYAAGPPPPQMYGPPPPQRRPVQMAYGIPPDM
Download sequence
Identical sequences A4I6H3
psu|LinJ31_V3.0820 5671.LinJ31.0820 gi|146094652|ref|XP_001467342.1| XP_001467342.1.40037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]