SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154333685|ref|XP_001563099.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154333685|ref|XP_001563099.1|
Domain Number 1 Region: 27-577
Classification Level Classification E-value
Superfamily SIS domain 2.11e-210
Family Phosphoglucose isomerase, PGI 0.00000000000000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154333685|ref|XP_001563099.1|
Sequence length 581
Comment glucose-6-phosphate isomerase [Leishmania braziliensis MHOM/BR/75/M2904]
Sequence
MATATFNAPYEIARKTKVLGASDSSLSKLSAWKRLEFLYEKYGNESILSHFEKDQQRFSR
YSIEVPLQCDDNFLFLDYSKSHINDEVKDALVALAEERGVRAFIKAMFDGQQVNSTEKRA
VLHVALRNRSNRAINVNGKDIMTDVNLVLAQMKDFTDKVRSGEWKGQTGKSIHYIVNVGI
GGSDLGPVMVYESLKPFSMRDMHCFFVSNVDGTHMAEVLKQVNMEETIFIIASKTFTTQE
TLTNAMSARNAFIDYLKSNNIPSDGAVAKHFVAISTNAKEVREFGIDTANMFEFWDWVGG
RYSVWSAIGLSVMLSIGYENFVEFLTGAHVIDNHFASAPVEQNLPMMLALVGIWYNNFFG
AETQAVLPYDQYLWRLPAYLQQLDMESNGKGVTKKSGAVTVQTGPIIFGEAGTNGQHAFY
QLIHQGTKIIPCDFIGCVQTQNRVGDHHRILMSNFFAQTEALMVGKSAEEVRQELVKSGM
PSDAIESLLPHKTFTGSRPSNSILVNALTPRALGAIIAMYEHKVLVQGAIWGINSYDQWG
VELGKVLAKSILPQLKSGNIVSNHDGSTNGLINMFNTRAHL
Download sequence
Identical sequences A4H6W2 A7UFI1
psu|LbrM12_V2.0490 XP_001563099.1.15230 gi|154333685|ref|XP_001563099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]