SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154344018|ref|XP_001567953.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|154344018|ref|XP_001567953.1|
Domain Number - Region: 30-75,207-245,336-388
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000787
Family WD40-repeat 0.03
Further Details:      
 
Domain Number - Region: 439-527
Classification Level Classification E-value
Superfamily SIS domain 0.00978
Family mono-SIS domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154344018|ref|XP_001567953.1|
Sequence length 591
Comment hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Sequence
MTAQTAPEAGKKKAAATVLAPAAPSPPFDFHTVTCVTWSASGRNIGVGTTDGFLIYSTEP
LVSNLSGTSTSQSTLDRSAEAAGLLAADVHNPMLQEVCRCAVYGGVGLLNLYKQCSLVAF
TGVQRRSAAARIQLADTSVQPPSDFYAPSAPPPSAGVAPATPPVPRCKPWPPEEDAAAAQ
WYERWRVSVFASSSAATATTVSTLAFVVCPPTVVGLNFCPHAVIAVASGDPKIVGSHTLH
VFDHHLHPLYTLSVYPPSSNAYLKDMVAIAATPTLSNGAGMIVQRLRVLLPGEKRGEVRL
LTFKKSALTAASFEEAAHDDYTNHPGSAYRQGYGDTHRLVDKVLHQAPLRAVAITEDGKS
GVTMSEQGMRIRVLDFVGDDKMINRLTLDRGHLPAVVDTVSLAIVSVPQAQPLMQNAATA
TAYTHERCGSNDNNAPVHVSETLSRQYQRLTEVVHDIVVCLTSSGTTHIFGCGLQQVLFY
HSDKTLLPRVGYPYAFSVCLPPLLAKEGVVSIFVARSDASTSAVHYLPRHEHCNAKGGRD
DCSNSATHHLPGEFFAFQLRYHSSSAATAATGGAGSTSKCTTLVRFTLSSP
Download sequence
Identical sequences gi|154344018|ref|XP_001567953.1| psu|LbrM33_V2.1850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]