SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154416182|ref|XP_001581114.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154416182|ref|XP_001581114.1|
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.92e-20
Family Ricin B-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154416182|ref|XP_001581114.1|
Sequence length 246
Comment QXW lectin repeat family protein [Trichomonas vaginalis G3]
Sequence
MNCYFINAAHKEYLLTIADKSCAERDGQLVIWKFERGLHNQFILFKERMVNALSGCLLEP
ENPDLGSIVIQDHVSKRQERWFYYPDQTIRNSKGLCLDVQGARFEDGTPVILWEVNGKEE
QKWIPATVFVQKVKKGKKHHHKHHSKKEPKPEEKKEEQPAEEKKDSSDDEKKKKGFFEKV
ADKISDALSSSSSSDEKEGDAPAEGGENPEGKKRKHRKHHSHSKDGEHKHRKHHSHSKDG
EEKPQQ
Download sequence
Identical sequences A2DHT0
gi|121915338|gb|EAY20128.1| gi|154416182|ref|XP_001581114.1| XP_001581114.1.43485 92921.m00271 5722.A2DHT0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]