SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156081935|ref|XP_001608460.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156081935|ref|XP_001608460.1|
Domain Number 1 Region: 158-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000255
Family EGF-type module 0.0068
Further Details:      
 
Weak hits

Sequence:  gi|156081935|ref|XP_001608460.1|
Domain Number - Region: 27-108,136-196
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00033
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156081935|ref|XP_001608460.1|
Sequence length 219
Comment ookinete surface protein Pvs25 [Plasmodium vivax SaI-1]
Sequence
MNSYYSLFVFFLVQIALKYSKAAVTVDTICKNGQLVQMSNHFKCMCNEGLVHLSENTCEE
KNECKKETLGKACGEFGQCIENPDPAQVNMYKCGCIEGYTLKEDTCVLDVCQYKNCGESG
ECIVEYLSEIQSAGCSCAIGKVPNPEDEKKCTKTGETACQLKCNTDNEVCKNVEGVYKCQ
CMEGFTFDKEKNVCLSYSVFNILNYSLFFIILLVLSYVI
Download sequence
Identical sequences A5KDY7 O96555
5855.PVX_111175 gb|PVX_111175 gi|156081935|ref|XP_001608460.1| XP_001608460.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]