SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156093912|ref|XP_001612994.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156093912|ref|XP_001612994.1|
Domain Number 1 Region: 187-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000195
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156093912|ref|XP_001612994.1|
Sequence length 250
Comment merozoite surface protein 4 [Plasmodium vivax SaI-1]
Sequence
MKVAYFLSVLDLLIIFSLYFDGRRSAFAGIAACIRHGRILGEGGEQSGGASGGSSGGSSG
DSSGGLSGGSSGGPSPPAGSSGSGGSDPANSATGPQNSTPGSGGQTGDHSAEAENGDYNE
QGDDHGDDHGDDHGDDHGDDHGDDHGDDHGDDHGDDHGDEQDGEDYDDAEDDDLYELSEV
DENANLCLDNNGGCGDDKICENLGKGIVKCLCKPGYKLVGTECVESSKSSSLNSFFCWFL
LVIIVLASIN
Download sequence
Identical sequences A5KBL7
5855.PVX_003775 gi|156093912|ref|XP_001612994.1| gb|PVX_003775 XP_001612994.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]