SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156094296|ref|XP_001613185.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156094296|ref|XP_001613185.1|
Domain Number 1 Region: 426-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000234
Family Merozoite surface protein 1 (MSP-1) 0.018
Further Details:      
 
Domain Number 2 Region: 380-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Merozoite surface protein 1 (MSP-1) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156094296|ref|XP_001613185.1|
Sequence length 487
Comment merozoite surface protein 8 [Plasmodium vivax SaI-1]
Sequence
MRKNAQIVIFCLFGLLSYRCGAEGNVSPPNFNDNRVNGNNGNKGNGNDNDVPSFIGGNNN
NVNGNNDDNIFNKNGKDVTRNDGDAKDGENRNNKKNENGSGSNENNSIANADNGSGKSDA
NANQIDEDGNKMDEASLKKILKIVDEMENIQGLLDGDYSILDKYSVKLVDEDDGETNKRK
IIGEYDLKMLKNILLFREKISRVCENKYNKNLPVLLKKCSNVDDPKLSKSREKIKKGLAK
NNMSIEDFVVGLLEDLFEKINEHFIKDDSFDLSDYLADFELINYIIMHETSELIDELLNI
IESMNFRLESGSLEKMVKSAESGMNLNCKMKEDIIHLLKKSSAKFFKIEIDRKTKMIYPV
QATHKGANMKQLALSFLQKNNVCEHKKCPLNSNCYVINGEEVCRCLPGFSDVKIDNVMNC
VRDDTLDCSNNNGGCDVNATCTLIDKKIVCECKDNFEGDGIYCSYSIFNSINNFIFLILL
LLCLYLF
Download sequence
Identical sequences A0A0J9U2Z3 A5KAU1
5855.PVX_097625 gb|PVX_097625 XP_001613185.1.43797 gi|156094296|ref|XP_001613185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]