SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156097618|ref|XP_001614842.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156097618|ref|XP_001614842.1|
Domain Number 1 Region: 1642-1684
Classification Level Classification E-value
Superfamily EGF/Laminin 9.49e-17
Family Merozoite surface protein 1 (MSP-1) 0.00037
Further Details:      
 
Domain Number 2 Region: 1686-1731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000988
Family Merozoite surface protein 1 (MSP-1) 0.00061
Further Details:      
 
Weak hits

Sequence:  gi|156097618|ref|XP_001614842.1|
Domain Number - Region: 1025-1103
Classification Level Classification E-value
Superfamily t-snare proteins 0.0196
Family t-snare proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156097618|ref|XP_001614842.1|
Sequence length 1751
Comment major blood-stage surface antigen Pv200 [Plasmodium vivax SaI-1]
Sequence
MKALLFLFSFIFFVTKCQCETESYKQLVAKLDKLEALVVDGYELFHKKKLGENDIKVETN
ASANNNNNNQVSVLTSKIRNFLSKFLELQIPGHTDLLHLIRELAVEPNGIKYLVESYEEF
NQLMHVINFHYDLLRAKLHDMCAHDYCKIPEHLKISDKELDMLKKVVLGYRKPLDNIKDD
IGKLETFITKNKITIKNISDLIIAENKKRSGHPTTTTNGAGTQPANGSIAAASSETTQIS
GSSNSGSSSTGSSNSGSSSTGSSGTGSTGTGQSPPAAADASSTNANYEAKKIIYQAVYNT
IFYTNQLQEAQKLIAVLEKRVKVLKEHKDIKVLLEQVAKEKEKLPSDYPNTTNLTNVHKE
AESKIAELEKKIEAIAKTVNFDLDGLFTDAEELEYYLREKAKMAGTLIIPESTKSAGTPG
KTVPTLKETYPHGISYALAENSIYELIEKIGSDETFGDLQNPDDGKQPKKGILINETKRK
ELLEKIMNKIKIEEDKLPNLKKEYEEKYKVYEAKVNEFKPAFNHFYEARLDNTLVENKFD
DFKKKREAYMEEKKKLESCSYEQNSNLINKLKKQLTYLEDYVLRKDIADDEIKHFSFMEW
KLKSEIYDLAQEIRKNENKLTIENKFDFSGVVELQVQKVLIIKKIEALKNVQNLLKNAKV
KDDLYIPKVYKTSEKPEPYYLMVLKREIDKLKDFIPKIESMIATEKNKPTVAAADIVAKG
QSLRGASETGTTGNTVNAQTAVVQPQHQVVNAVTVQPGTTGHQAQGGEAETQTNSVQAAQ
VQQTPAGAGGQVASTQTISQAPAPTQASPEPAPAAPPSTPAAAVAPAPTMSKLEYLEKLL
DFLKSAYACHKHIFVTNSTMKKELLDQYKLNADEQNKINETKCDELDLLFNVQNNLPAMY
SIYDSMSNELQNLYIELYQKEMVYNIYKNKDTDKKIKAFLETLKSKAAAPAQSAAKPSGQ
AGTTPVTTTAPVTTTTVTPSPQTSVVTSTPPTPQAEENRRVGGNSEEKPEADTAQVEKFY
EKHLSQIDKYNDYFQKFLESQKDEITKMDETKWKALGAEIEELKKKLQVSLDHYGKYKLK
LERLLKKKNKISNSKDQIKKLTSLKNKLERRQNLLNNPTSVLKNYTAFFNKKRETEKKEV
ENTLKNTEILLKYYKARAKYYIGEPFPLKTLSEESMQKEDNYLNLEKFRVLSRLEGRLGK
NIELEKENISYLSSGLHHVLTELKEIIKNKKYSGNDHTKNIAAVKEALQAYQELIPKVTT
QEGASTTAATLPVTVPSAVPGGLPGAGVPGAAAGLTPPPPAGSVPATGPGAAAGSTEENV
AAKAQDYAEDYDKVIALPLFGNNDDDGEEDQVTTGEAESEAPEILVPAGISDYDVVYLKP
LAGMYKTIKKQLENHVNAFNTNITDMLDSRLKKRNYFLEVLNSDLNPFKYSSSGEYIIKD
PYKLLDLEKKKKLIGSYKYIGASIDMDLATANDGVTYYNKMGELYKTHLDGVKTEIKKVE
DDIKKQDEELKKLGNVNSQDSKKNEFIAKKAELEKYLPFLNSLQKEYESLVSKVNTYTDN
LKKVINNCQLEKKEAEITVKKLQDYNKMDEKLEEYKKSEKKNEVKSSGLLEKLMKSKLIK
ENESKEILSQLLNVQTQLLTMSSEHTCIDTNVPDNAACYRYLDGTEEWRCLLTFKEEGGK
CVPASNVTCKDNNGGCAPEAECKMTDSNKIVCKCTKEGSEPLFEGVFCSSSSFLSLSFLL
LMLLFLLCMEL
Download sequence
Identical sequences A5K724 Q26194
5855.PVX_099980 gi|156097618|ref|XP_001614842.1| gb|PVX_099980 XP_001614842.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]