SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156101047|ref|XP_001616217.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156101047|ref|XP_001616217.1|
Domain Number 1 Region: 415-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000405
Family Merozoite surface protein 1 (MSP-1) 0.031
Further Details:      
 
Domain Number 2 Region: 368-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000192
Family Merozoite surface protein 1 (MSP-1) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156101047|ref|XP_001616217.1|
Sequence length 479
Comment merozoite surface protein 10 [Plasmodium vivax SaI-1]
Sequence
MKRAKCNKSLTFTIFLLLYVNGAVHVSANELNGTDGGDVPNQKDITKDYSIFERITSEGQ
SASGKDDSPISQSNTPQGEEASDGKQGNTPLDEKNSAKDVEAHFIREGHDKVTHSDVGTE
EGKATGHVQKNANLRSTSYFSTQGAVSQAYNFVQENHPQLDNNGANVEQVARGQDDVGST
ENGEGNSGGEGNPLGSDKPGGKPEDASKDTPGNNPEESPNRNQEKGEKEKKERGDTDNPN
RGKTSEKADQQGGNHPNGLSPDEKNNPKTHNNHSESITNPGDVGALDGEENGEGDDQTGI
SPTEEHPTGDAPPSDHAEKIKNTLLKEGIDLKETTSMIDNAVYNMEQFILKTKFYTTAIR
NFVHFKVNHICEYSKCGANARCYIVEKDKEECRCRANYMPDDSVDYFKCIPMVEKDCSKE
NGNCDVNAECSIDKNKDIKCQCKFNYIGDGIFCVMGSQAKQSLCLLLLLLICLLHKFLF
Download sequence
Identical sequences A0A0J9SS55 A0A0J9TAU7 A0A0J9V1V2 A0A1G4HFH2 A5K240
gb|PVX_114145 5855.PVX_114145 gi|156101047|ref|XP_001616217.1| XP_001616217.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]