SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156102921|ref|XP_001617153.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156102921|ref|XP_001617153.1|
Domain Number 1 Region: 243-361
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 3.66e-26
Family Elongation factor TFIIS domain 2 0.0051
Further Details:      
 
Domain Number 2 Region: 77-153
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2.09e-18
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0021
Further Details:      
 
Domain Number 3 Region: 388-434
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 6.12e-16
Family Transcriptional factor domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156102921|ref|XP_001617153.1|
Sequence length 435
Comment transcription elongation factor [Plasmodium vivax SaI-1]
Sequence
MHSHKLPLSVRRPPAPPPQDFFFFNPPVKNMTLTENIAKITTIQERLKDKESKFVSANEE
EAEEEAEAGAEAEEQKKTIDESTIKEIIEDLISLKDVEINKDILKQTKIGVTVNKFTKIK
NEEIQNVAKDLVDKWKNIAIKEKHSSTGSRSAESLKKRKSELVEGSDNNTCSEDYELKKV
KVKNVSEHSAKQGTIQSGSPNHGEPNNKADHLLFSKHHNSDHLPIKGSVQNSYHFSELKH
VNTDLKALTEWNYNGKFHNDVLRDKAKQFLFKAFITGSDDNLLYLIDRKKLNDIIYNIEN
ELHKFFIEKKQSQKEYNMQLKSIKFNLCDKKNPSFNEKIYAEYIPPRTIATMNSQEMASD
EKKKERNKCLQESLQACQSDWDVKNILLKKTRKGEFQCFKCKGYETVYHQLQTRSSDEPM
TTFVTCLKCNNRWKF
Download sequence
Identical sequences A0A0J9SMK5 A0A0J9T3U9 A0A0J9TQZ6 A0A1G4HK66 A5JZL5
XP_001617153.1.43797 5855.PVX_122950 gi|156102921|ref|XP_001617153.1| gb|PVX_122950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]