SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157432646|gb|EDO76905.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157432646|gb|EDO76905.1|
Domain Number 1 Region: 1064-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Integrin beta EGF-like domains 0.063
Further Details:      
 
Weak hits

Sequence:  gi|157432646|gb|EDO76905.1|
Domain Number - Region: 577-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000262
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 253-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000363
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 818-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.026
Family Integrin beta EGF-like domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157432646|gb|EDO76905.1|
Sequence length 1093
Comment Neurogenic locus notch-like protein [Giardia lamblia ATCC 50803]
Sequence
MKFFKTACCLVGFLASVSTDAHPDEVASTGKTHYFKKSLSKPLLRTSFDIKESNRCKWNE
VYVHEKCVPRECVYEGVECNSRGVCQQGHGDSYRCHCDDDMHYLPDWGCVPTPCIGDTPI
PCQGGICSEVLAGLYACECLPGMVFAGYCAIPTCIQHPEQGVCSRVGVCADTCQCPPLHA
GDYCEMCTNDAQMVGGKCISHACIDTSGLVCSGRGICAGVNPNFYCACNENYIAINSSTC
VHRNCIDASYEPLVCHGHGECIDNRCSCDDQWWGSFCERPAEPCMPTEVFVDGSCFPRSC
VVENSICNTHGDCIGGVCHCYTYASAHSTLLCYPTTCLFDRNGYMVPCPHGQCTYESQML
GYQCRCYNGYVKIDKECQPSYCVSDIYQSKASLCGGVGFCDLDHGCLCPQSITGRYCTLT
TFATTLSRQFPRLNIFALCEDGFLLINGSCVSKACLTGEKEVCYGDRGYCVHTQRYGWGC
RCYSHYTGPTCSVCSSKGVMINGQCIPALCTVLLSSGDYVECGGHGVCNISTQPNDSSDP
MEVIVCVCDDLSYPIEKTCISKTCITTSPFLKSDFRIICSGHGVCEIDSCLCFGEYTGPE
CSYRNDLICVDGYQPIDGKCVPSECVYIDTICGGHGECISFESGSNSCKCYEGFSLTSIY
GCQPTVCVNSEGLLCKDGTCVQISPNAYECQCQEEYAASHGECHPRECVDWNGNLCNTDR
GRCIYDTRFSSFRCECLDGYSGVFCAQCSNYAVRINGVCVPPQCYIDDGNNVHICGGFGT
CIYQYKKASYCVCDDGAAVQANGQCASWACVQPGLVTNMACSGFGICANERCICNSIFYG
TYCEKVQPNCGPAQIFIKSKEECIPLVCVSNETICNDHGECIRGETTNGVVRAFCQCSPG
YALYNNTLCVPPGCIIHGELCPDGHCTNDLIAPCICDDNYTWTGVECTPNICLNGKDMYG
KYIICSARGSCDSKQGCNCLSIYEGKLCEECGRQGLVINGTCFPSHCVQVSNGTYTICNN
YGSCERSFLGNSEDTYRCACRLPSVDIKDGGCYSPLCIPDPISRLVCNGHGFCDGGHCIC
QKGYKGRRCEHKS
Download sequence
Identical sequences A8BVL6
gi|157432646|gb|EDO76905.1| gi|159108619|ref|XP_001704579.1| XP_001704579.1.56740 NYSGRC-SEC-GL50803_92495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]