SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159119492|ref|XP_001709964.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159119492|ref|XP_001709964.1|
Domain Number 1 Region: 228-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000177
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Weak hits

Sequence:  gi|159119492|ref|XP_001709964.1|
Domain Number - Region: 13-67
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00036
Family BSTI 0.065
Further Details:      
 
Domain Number - Region: 119-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0598
Family Integrin beta EGF-like domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159119492|ref|XP_001709964.1|
Sequence length 257
Comment Tenascin precursor [Giardia lamblia ATCC 50803]
Sequence
MLFVSLAAFAWAVSCPEDEVLIDDQCIKKTCVGFNQLECMGYGKCMNGICLCDDGFVLQG
TFKCIPITCIVDGKMCPNGLCQQNVSGNWYCGCNTNYTPSGGRCIPNECVTGMFESGEAE
ICHTRGVCDIENKVCTCSYLYAGFHCNVCSADAEVLDGDTCAPSICVHEDKSGHRSICGG
HGKCIRYDVSPYPDDFIYMCECDVGYTNILADNCVNDHCVDPEHPSKECSGHGECKDNRC
VCKDNYAGSYCEIKHEH
Download sequence
Identical sequences A8B2G0
XP_001709964.1.56740 gi|157438082|gb|EDO82290.1| gi|159119492|ref|XP_001709964.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]