SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|165901101|gb|EDR27261.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|165901101|gb|EDR27261.1|
Domain Number 1 Region: 11-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.84e-16
Family Thioltransferase 0.025
Further Details:      
 
Domain Number 2 Region: 254-330
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000403
Family PDI-like 0.026
Further Details:      
 
Domain Number 3 Region: 307-432
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000533
Family Thioltransferase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|165901101|gb|EDR27261.1|
Sequence length 508
Comment hypothetical protein, conserved [Entamoeba dispar SAW760]
Sequence
MTIILLLLILQISNGLYNLNYTNFEEALKQNQYIFIKFTITKNCPFCIDYTREFNQLSMF
MDIPFGSVICEDKDIELCEKQNITVLPTSILYKDGKQYRSLYGMYEYGNIKQWIKNMLEP
TYIEVKNEEEIKTYRADNMVLITSYFPNKKDEQDYHSMLEYISNDVKRFKQQFIYIINDK
YKKPTIVINSITSEDDEYSLEFELERNQTRLEFKLLLGFIPPFSSLNNIQNLLEQIETPI
LHYIYDTKMSKSTLMKELAKKYQLKLPFVTERAQESKVLAGHSQQIYPCISISFGLQIYS
MNETIEITKENVENFIENFFSGKLQPAKKHRTSNPQLLSHQPPIITSDIYDEYIKEDAAI
VICPFSFIKCQEYINSVMKGIYQAFENTPIKFGVIDIEEDDIISEEQIVSYPTIILTTKD
VNKTHIIMKPITSFDPIEIINEINIHCQFKLTLSDKEVIQLRKNIEQIVTVIRANEIVEN
ENENENIQNQEINNQNDLISKEKKKEEL
Download sequence
Identical sequences B0EDY2
gi|165901101|gb|EDR27261.1| gi|167383329|ref|XP_001736491.1| jCVI|EDI_344670 XP_001736491.1.18373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]