SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|165904207|gb|EDR29512.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|165904207|gb|EDR29512.1|
Domain Number 1 Region: 1-79,111-160
Classification Level Classification E-value
Superfamily MTH1598-like 1.66e-32
Family MTH1598-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|165904207|gb|EDR29512.1|
Sequence length 160
Comment hypothetical protein, conserved [Entamoeba dispar SAW760]
Sequence
MSFEYLDHPADVILHSWGKNIIEAFENAAAGMFNFMSDLTRVEEKEIKTISIDATSYEEA
LVKFLDSWLCVFSSDLFIGKSFKCEVFDDNDEEHIHIECKGFVVMLRKIVFYNTNQYRIG
EYFIIGKHQQGTEIKAITWHNLEIYDDEKDQTHIHILLDI
Download sequence
Identical sequences B0E7I4
jCVI|EDI_349410 XP_001734339.1.18373 gi|165904207|gb|EDR29512.1| gi|167377267|ref|XP_001734339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]