SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169802085|gb|EAL42991.2| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169802085|gb|EAL42991.2|
Domain Number 1 Region: 585-720
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000000039
Family Ricin B-like 0.013
Further Details:      
 
Domain Number 2 Region: 755-801
Classification Level Classification E-value
Superfamily RPA2825-like 0.0000575
Family RPA2825-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|169802085|gb|EAL42991.2|
Sequence length 807
Comment hypothetical protein EHI_164470 [Entamoeba histolytica HM-1:IMSS]
Sequence
MHSQNISLFKDINDISKGLSDQFRNIISKCTKPHFICICGDQDSDENTNIHQIINGISSN
DCFNAQESLKSSNKISTSESNNCNVIGPILVSDIVKRNNLEEQEFQQILNDELFFIEIEK
HKLISSTTPNNIVEILSILQLSSIRIIYNNNEINAGILEDISSFDYLSCLLELQGIRKEG
KRVICISPDIKTITEKENETILKESVLNKQKHINNDLVHFFSTKSHQTNCLCFLLPSYSH
PSPSQIICNIYKEQMKCIISEILHEIPLNCKSGSYVLSCIELLIELFKSINELNINTISN
EIQRLFKKKYVETISSINIKLVGMIYEMNLNDRINVIENQSKIKSLVYQIIEIEFIPIWD
ILHIIYGNQLINELFDSISITSKHLEEFILKDIQKIIDDLIHCNDFRLTPMWNYLTQLQI
KEQFEQENYSTIINNYLAQTLTSNQKILQFYSNKKCTTVNELKHQCIDTITLKTNEILNR
KPQWRDVYITIKNYYHNLINTIDKEVQTKELSTVRQVELCHQYYLGLFTSKSETYTTQHE
QIIFNKNDYNTILQDALNELNAFFDKKKQIAQELEQKKEAFIKKLTSKSYYIMPCCTTRY
VLDAKYSDFTDGQPITLYWSHGNQNQSFQFIQKNDLFQIKIGHNGFLVHRNDSSEGSVIH
QWNDTTSINSLWKIIENHDGTISFLSASNESLAFTADSNELISLCHTCYFTCSDYQKFKL
LESPLNNQPIPLPPTNQETPNHQTQFFQIPKYVGPSIVEALNNIHVDSSFSYRERIAQVN
NIQEYHGSAYQNDYMRKLLYQGRLIKP
Download sequence
Identical sequences A0A175JN79 C4M1S8
gi|169802085|gb|EAL42991.2| gi|183232358|ref|XP_648378.2| XP_648378.2.49425 jCVI|EHI_164470 294381.C4M1S8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]