SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169802352|gb|EAL51863.2| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169802352|gb|EAL51863.2|
Domain Number 1 Region: 115-414
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-94
Family Protein kinases, catalytic subunit 0.000000201
Further Details:      
 
Domain Number 2 Region: 3-98
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-21
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169802352|gb|EAL51863.2|
Sequence length 440
Comment protein kinase, putative [Entamoeba histolytica HM-1:IMSS]
Sequence
MSDVLKRGVMIKEGSKVKNWKKRWFVFHNNGMLDYFTDKKETDQKGSVDMNRASSLRKTE
DKKRIMLEILLETKVFRLAFDSETTRDEWTTVFQKFIDEKCSKSDQSSNALKPKLEDFET
LKLIGKGTYGKVMLVKKIDTGKIYAMKILDKKAVVETNEVEHTMAEREVLGTIDNPFIVH
MHYSFQTENKLYFVMDFINGGELFYHLQNERRFSIARAKFYAAEILLALEHLHLHGIIYR
DLKPENVLLNADGHVCITDFGLSKTGMKGEGDMTSTFCGTAAYLAPEILLGEKYDSAVDW
WSFGILTYEMMVGIPPFYSEDEREMYQNIVNEAVRYPPNTPSSIKTFIDALLEKNPTRRL
TDTTIMKHHPFFQGLDFDRLMKKEVVPPYIPQVHSADDVANIDPYFLGETDAAIAEEKNS
NTSGGQEFKFDGFTYISKKD
Download sequence
Identical sequences A0A175JLD1 B1N2G7
jCVI|EHI_044470 jCVI|EHI_137850 294381.B1N2G7 EnhiA.01510.a XP_001913383.1.49425 XP_657249.2.49425 gi|169802352|gb|EAL51863.2| gi|169803071|gb|EDS89830.1| gi|183229908|ref|XP_001913383.1| gi|183231732|ref|XP_657249.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]