SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183230509|ref|XP_648475.2| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183230509|ref|XP_648475.2|
Domain Number 1 Region: 594-729
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000000000532
Family Ricin B-like 0.013
Further Details:      
 
Domain Number 2 Region: 764-810
Classification Level Classification E-value
Superfamily RPA2825-like 0.0000589
Family RPA2825-like 0.0076
Further Details:      
 
Weak hits

Sequence:  gi|183230509|ref|XP_648475.2|
Domain Number - Region: 518-573
Classification Level Classification E-value
Superfamily MTH1598-like 0.0497
Family MTH1598-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|183230509|ref|XP_648475.2|
Sequence length 816
Comment hypothetical protein [Entamoeba histolytica HM-1:IMSS]
Sequence
MHSQNISLFKDINDISKGLSDQFRNIISKCTKPHFICICGDQYIDENTNIHQIINGISSN
DYLNAQESLKSSNKISTSESNNCNVIGPILVSDIVKRNNLEEQEFQQILNDELFFIEIEK
HKLTSSTTPNNIVEILSILQLSSIRIIYNNNEINAGILEDISSFDYPSCLLELQGIRKEG
KRVICISPDIQTITEKENETILKESVLNKQKHINNDLVHFFSTKSHQTNCLCFLLPSYSH
PSPSQIVCNIYKEQMKCIISEILHEIPLNCKSGSYVLSCIELLIELFKSINELNINTISN
EIQRLFKKKYVETISSINIKLVGMIYEMNLNERINVIENQSKIKSRVYQIIENEFIPIWD
ILHIIYGNQLINELFDSISITSKHLEEFILKEIQKIIDDLIHCNDFRLTPMWKYLTQLQI
KEQFEQENYNTIINNYLAQTLTSNQKILQFYSNKKCTTVNEVKHQCIDTITLKTNEILNG
KQQWRDVYITVKNYYHNLINTIDKEVQTKELSTVRQVELCHQYYLGLFTSKSETYTTQHE
QIIFNKNDYNDILQDALNELNALFDKKKQIAQSLEQTHLKEELEQKKEAFIKKLTSKSYY
IMPCCTTRYVLDAKYSDFTDGQPITLYWSHGNQNQSFQFIQKNNLFQIKIGHNGFLVHRN
DSSEGSVIHQWNDTTSINSLWKIIENHDGTISFLSASNESLAFTADSNELISLCHTCYFT
CSDYQKFKLLESPLNNQPIPLPPTNQETPNHQTQFFQIPKYVGPSIVEALNNIHVDSSFS
YRERIAQVNNIQEYHGSAYQNDYMRKLLYQGRLIKP
Download sequence
Identical sequences A0A175JG68 C4LUZ5
jCVI|EHI_092310 gi|169802878|gb|EAL43085.2| gi|183230509|ref|XP_648475.2| 294381.C4LUZ5 XP_648475.2.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]