SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193807876|emb|CAQ38580.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193807876|emb|CAQ38580.1|
Domain Number 1 Region: 25-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.22e-33
Family PDI-like 0.00088
Further Details:      
 
Domain Number 2 Region: 317-461
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.01e-30
Family PDI-like 0.0013
Further Details:      
 
Domain Number 3 Region: 223-351
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.71e-16
Family PDI-like 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|193807876|emb|CAQ38580.1|
Domain Number - Region: 146-236
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00101
Family PDI-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193807876|emb|CAQ38580.1|
Sequence length 482
Comment disulfide isomerase, putative [Plasmodium knowlesi strain H]
Sequence
MRTKLLSLFLFLIPLVLRNYARAHEDLFNEHITTIHDGELNNFITKNDVVLVMFFAPWCG
HCKRLIPEYNEAANMLAEKKSEIKLASVDATTENALAQEYGITGYPTMIMFNKKNRVNYG
GGRTAQSIVDWLQQMTGPVFTEITTNIEEVLKEKNIAVAFYLEYTSEDNELYKNFNEVGD
KNREIAKFFVKKNDKHNKISCYRKDEKKVDYDEKVSLSEFVSTESFPLFGEINTENYRFY
AESPKELVWVCATTEQYNEIKEEVRLAASELRAKTHFVLLNIPEYADHARASLGLNEFPG
LAYQSSEGRYLLPNAKESLHNHKAIVTFFKEVEEGKVEKSLKSEPIPEEDKNAPVKVVVG
NSFIDVVLKSGKDVLIEIYAPWCGHCKKLEPVYEDLGRKLKKYDSIIVAKMDGTLNETPI
KDFEWSGFPTIFFVKAGSKVPLPYEGERSLKGFVDFLNKHATNTPISLDGVPGMEDGTAE
EL
Download sequence
Identical sequences A0A1A7W2J6 B3L111 Q2XQR5
XP_002258043.1.91479 5850.PKH_050300 PKH_050300 gi|193807876|emb|CAQ38580.1| gi|221053338|ref|XP_002258043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]