SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193808651|emb|CAQ39354.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193808651|emb|CAQ39354.1|
Domain Number 1 Region: 1713-1755
Classification Level Classification E-value
Superfamily EGF/Laminin 3.63e-16
Family Merozoite surface protein 1 (MSP-1) 0.00029
Further Details:      
 
Domain Number 2 Region: 1757-1801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000152
Family Merozoite surface protein 1 (MSP-1) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193808651|emb|CAQ39354.1|
Sequence length 1821
Comment merozoite surface protein 1, MSP-1 [Plasmodium knowlesi strain H]
Sequence
MKALLFLFSLIFFVTKCQCETEDYKQLLVKLDKLEGLVVDGYELFHKNKISLDNIDAVQN
IDGNNVNALAYKIRDIVGKYLELQIPGHGNLLHMIRELALDANGLKYLVENYEEFNQLMH
VINFNYDLLRAKLNDMCAHEYCKIPEHLKISAKELDMLKKVVLGYRKPLDNIKDDIGKME
AFINKNKETINNINQLITAENAKIVGHPINGVNVTGASSDAVANTGTPVAAAAGAAAAAV
PGAIASPSPVESSTPENYDQKKVIFQAIYNFIFYTNQLEEAQKLMQVLEKRVKLLKEHKS
IKALLEQIATEKNNLTTNNATTGGATTIPEEVQKKIADLEKQIVAIAKTVNFDMDGLFTN
VEELEYYLREKAKMAGTLIGPESSQSTGTPGKAVPTLKETYPYGITYALPERTIYELIEK
FGSEESFGDLQNPDNGRQPNKGIIINETKRKTLVDKIMSKIKLEEEKLPKLKKEYDEKME
QYKQKVQDFLPTLKYFYEGKLDNTLVGSKFDEFKNKREAYMKEKEELEKCTYEQSINLIN
KLKKQLTYLVDYTLKKDVTEDEINYFSDLEWKLKNEIYELAKEVRKNENKLIMENKFDFS
GVLELQIHKVLMIKKIGALKNVQNLLKNAKLKDKLYIPKVYKTGQKPEPYYLIVLKKEID
KLKDFIPKIETMIATEKAKAPTEPVKVRAQSLRGASETAPSEPPTATESGSTTSASTAVQ
QPTQQAAQAAQAASPVTVTQPTETVTQTPAPATETAGEAAQETSPVSPTAPAVVSEAGTE
GGEGTTEVVAQPEAASGETQTPTPGAVDASPAAPVPAGTPGTTDAAPEASVPAPAGSALP
ATTAPAAAAPAAPAMSKLEYLEKLLEFLKSSYACHKHIFLTNSTMNPELLKQYALTTDEE
KKIKESACDELDLLFNVQNNLPSMYSIYDTMINDLQNLYIELYQKEMVYNIYKNKDTDTK
IKAFLETLKSNAASVTPAVVPAAAPVVTPAPAEPVVTPAPAPGQAAPAAAPTTTNPSTTP
SGTTTNAVSPTTAVTPGAQDTTQTTTQDTTVTEEGGVTVQASSEEEPETNIVNVEKIYEK
HLSQMDKYNDYFIKFLESQKEKITSMTEEQANALGAEIEALKKKVQVSLDHYGKYKLKLE
RFLEKKNKISNSKEHIKKLTSLKNKLERKLNFLNNPTSVLKNYIIFFNKKKEAEKKEVEN
TLKNTEILLKYYKARAKYYIGEPFPLKTLSEESLQKEDNYLNLEKFRVLSRMEGRLGNNI
NLEKENISYLSSGLHHVFTELKEIIKNKKYTGNDHAKNTTAVKEALQAYEELLPKVATQT
ASLPPVAPPAVVPPVVPEAEAEAEAEAEAEPATSTQPATADTAAPTQTPAAPTQTPAEPA
TATATTGETAAAPAAPAPVEVQNAEVKAQEYGEDYDKVITLPLFGNDEDDVEDQEEKQII
TGEAENAQPENIVPEGINEYEVVYIKPLAGMYKSIKKQLENHVAAFNTNITDMLDSRLKK
RNYFLDVLDSELNPFKYSSSGEYIIKDPYKLLDLEQKKKLLGSYQYIGASVDKDLITAKD
GMEYYNKMGELYKQHLEAVNAQIKEIEASVPGEQSQLNAQKEELKKYLPFLNSIQKEYES
LVNMAHTYKENLKKFINNCQIEKKETEIIVKKLEDYTKIDENLEIYKKSKKESDVRSSGL
LEKLKNSKLINEEESKKVLSQLLNVQTQMLNMSSAHKCIDTNVPENAACYRYLDGTEEWR
CLLGFKEVGGKCVPASITCEENNGGCAPEAECTMDDKKEVECKCTKEGFEPLFEGVFCSS
SSFLSLSFLLLILIFFLSMEL
Download sequence
Identical sequences B3L2X8
5850.PKH_072850 gi|193808651|emb|CAQ39354.1| gi|221054886|ref|XP_002258582.1| PKH_072850 XP_002258582.1.91479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]