SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193808772|emb|CAQ39474.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193808772|emb|CAQ39474.1|
Domain Number 1 Region: 558-603
Classification Level Classification E-value
Superfamily RING/U-box 4.04e-16
Family RING finger domain, C3HC4 0.0064
Further Details:      
 
Domain Number 2 Region: 369-466
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 5.23e-16
Family Cdc48 domain 2-like 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|193808772|emb|CAQ39474.1|
Domain Number - Region: 462-496
Classification Level Classification E-value
Superfamily F-box domain 0.0647
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193808772|emb|CAQ39474.1|
Sequence length 605
Comment hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H]
Sequence
MESCRRGESKHMHFLNNVNSKKKLNIVEKKGILEKVHILPIKRKCENTNALYRKLQLLIN
DQCVLNEGFIIAVNEEKERVPEGKNTRQNLKEGLTNDMEGTNKNENNTISTNSLEKISSS
KEESCKNADSWEVPHRKESNNHTPKKSSNEKNSMNKPNNDNICLNEKCSKEKLTDETYHF
EESTDYYVVVNCIPSKGILTRDTLIYTDGKYVDNLKKIHLIIIRDKYYKKYERKLKKKFF
SLKKYILKKGNQFFNEAMSLIPFSFDNFSSKCNTEKRKCSSSSSTFEGKNVDTVTTHRTT
TKRRSLVLEKILLTCLHPYFKKNRTKLFYSGKLLIINNFSFLVVKIDADVNVGFVDNSTE
ICLNADTYDPFRNVHIVPLYDTLPTTYNYDIFADYIKPYIERHYLSLFSMHDTFFYKGVQ
FKIMGIDPMNIKYGRGRITCNTFIYTDGAIKPTFFDVISNESINYIQCLPVEYKPYAVLN
ILQQLDADSLLRLFPSTNANLQESALNEQRILNHLDKYKYVYRNHTREDNQSGKMLLDVD
VEEQTDAKNKSSKFAYEQCAVCFESFQNYDKCIKLACLHTYHWKCVKNWFRFNLTCPCCR
RELII
Download sequence
Identical sequences A0A1A7VYB3 A0A1Y3DMG8 B3L3K4
PKH_080600 5850.PKH_080600 gi|193808772|emb|CAQ39474.1| gi|221055127|ref|XP_002258702.1| XP_002258702.1.91479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]