SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209880578|ref|XP_002141728.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209880578|ref|XP_002141728.1|
Domain Number 1 Region: 431-567
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.92e-22
Family PDI-like 0.002
Further Details:      
 
Domain Number 2 Region: 62-150
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.05e-18
Family PDI-like 0.011
Further Details:      
 
Domain Number 3 Region: 307-456
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000764
Family PDI-like 0.044
Further Details:      
 
Weak hits

Sequence:  gi|209880578|ref|XP_002141728.1|
Domain Number - Region: 141-223
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00193
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|209880578|ref|XP_002141728.1|
Sequence length 597
Comment thioredoxin family protein [Cryptosporidium muris RN66]
Sequence
MKLLALLTHLILVPFLSATYIPNPIDNINGNLSSISFSMNTNERLEASNVKQLGLVDLKN
FTSEIAVVLFYVPWCVFCREILPEFDKAANIMKEYNIPFGRLDANDNRQVVLLEQVPKFP
TIKIYFEGVGHYYTGISNSIAIVNFINSELNRDFHISNKKALENFIDRNNSGVKIIAIIN
STLNSSLPKPNITNEHESNDNNLNSNIPAYLKISRKYQHILFGHTYTNNSEVVEVLLGNS
SSYTDSSTVPLASVSSNLIIYTPWNNHKDIFGNYTSEDNVDTGRVIVKSIDLNSLEELDM
QVRKYEYPLIIRFVPLVTQRLFSDDRPLVFLFSSENDPTHNEVMKRFQKIARKFRGKLLF
IHSSTSLPHERRIRQVLASDDEQTPIISILKFSDVKNRDFKLNKIPMNPQQPPLVYRSSI
SGKGLLADSILENFIQDYTLGKLKPYFKSEEPPLDEENNGPVRIVVSTTFQSEVLNNVNQ
DTFIVFYAPWCGHCRKLEPDFNVLGQRLHNLKTLKIAKIDGSQNEIENIHILGYPSLMLY
PANKKSDPIWYDGDRSVHNMIIWLASHVTHQFDPEPFLNPDNAFEDDDLDMSRTGEL
Download sequence
Identical sequences B6AGN8
gi|209557334|gb|EEA07379.1| gi|209880578|ref|XP_002141728.1| gb|CMU_035510 XP_002141728.1.43237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]