SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|211966500|gb|EEB01696.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|211966500|gb|EEB01696.1|
Domain Number 1 Region: 480-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000011
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 705-829
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000118
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 1186-1313
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000126
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 907-1051
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000137
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 1390-1509
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000132
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 391-522
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 315-426
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000018
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 8 Region: 604-740
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000314
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 9 Region: 263-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000382
Family EGF-type module 0.046
Further Details:      
 
Domain Number 10 Region: 815-870
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000392
Family EGF-like domain of nidogen-1 0.044
Further Details:      
 
Domain Number 11 Region: 1050-1181
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000408
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 12 Region: 1341-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000104
Family EGF-type module 0.028
Further Details:      
 
Domain Number 13 Region: 1300-1339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  gi|211966500|gb|EEB01696.1|
Domain Number - Region: 163-307
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00471
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 859-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0529
Family EGF-like domain of nidogen-1 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|211966500|gb|EEB01696.1|
Sequence length 2182
Comment microneme protein, putative [Toxoplasma gondii ME49]
Sequence
MAILRSGIAVATLCVALGFTSQRGVVAETCPARFTAWTYCGGQNAMQERHNVACANIVES
RECEKPQSCGDFTEWVPSVANCREGQMQQRHREGCENHVERRMCTSPECVGKWTEWTYCN
SKGIQQRHNASCHVVEIRGCGDVPEGCGEFGPWSPPLDDFNNCKHGVVYRRKREGCDLEE
VRMCPKFDCSACSPNADCNKADSVCTCREGYEGDGLTCEPVNPCKNHNCSEHAVCFADGL
QAKCRCEKGYDGKEGAGTQDDPCIDRDECATNTHQCPAHSTCRNTEGSYDCDCKTGYAMS
ETGSCEDVNECATENSCPENSSCVNTAGSFECVCNEGFRMNAETQQCEDIDECAEEGGCS
ANATCTNSVGSYSCSCPEGYKGEGTRDSPCNKIDYCGEGLHDCGEHATCRNEAVGFTCIC
DAGYTGLGKVSSPCVDIDECDREHPTHDCDSNATCTNTEGSFTCACNTGYTGEGRGADTC
TEIDECADGTANCAAEATCTNTPGSFKCTCLEGYSGDGFTCSDNDECQQEPAPCHQSATC
QNTPGSFTCACNAGFRGDGHTCGDIDECAEDPNACGAHAVCRNTVGSFSCNCEEGYGNLD
EHRACHDINECEAEPERIPPNATCVNTDGSFEWSCNAGYEHVGSQCQKINFCARGFCSPH
ASCQEVSNGTSYECTCQPGYVGDGVGPEGCADRDECQTENHCSTDENGGICTNTEGSYTC
SCKEGYRQLADGTCEDIDECASGHECHESATCHNTAGSYTCSCNPGFSGDGHECADINEC
ETNAHDCGSHTTCENTVGSFVCNCKEGFVHSDEKTCRDVDECAENKHDCSVHATCNNTEG
SFECSCKAGFEGNGKECSDIQFCSAGRSDCAANADCAENEAGTDYACSCHAGYRGSGHTS
KGAADGCVDIDECTEGVDTCPRQGGRCVNTPGSYRCECEEGYTYTTKEDGTVECVDINEC
GVSEMNTCASKANGGVCTNTMGSYTCSCLPGYTPSDDGRVCTDIDECATENGGCSEHSQC
RNLPGSYECVCDAGYEKVEGSEHLCQDIDECAAGTATIPNNSNCVNTAGSYEFACKPGFE
HKDNACSKIDYCGRGGCNSLATCEETADGTDYVCTCPKGFVTQNEGRGADGCTDVDECAE
NGCAAYGSEGVICENTPGSFNCSCANGYLLNNGVCEEIDECAGSSSNTCADEGGICTNTP
GSYTCSCKPGYDQQGHDCVDINECTTQEPCGDNADCENTSGSYICKCKAGFEMRDNQCVD
IDECATNTNECHNHRGRCINTHGSYTCECIAGFIGDGKICINKNECQSGDFECGPNSHCV
DTEGSYKCDCNSGYKQDPENPDSCIDRDECEIEGACDENADCTNLPGSFSCTCRAGYRQE
GELCVKMNLCADDENGGCSPHADCEHLDKIVCTCRPGYEGDGITCTDIDECALNTDNCDS
HATCENTDGSYHCACGSGFTGDGFTCEDINECETGEHECDSNATCENIVGSYSCHCPTGF
AGDGRSCSPVEVVPGQESCNHWSAFTRCDPETHLSSRYCVDLPDKVESITCEVGSLPQPP
TVAPGEGGEEDGNACGPWGPWSPCPGEGNNMSTRRREDTESEACVNQVETMECPTQAGQA
CGNYGAFSDCGVPLRGFAMAFPENCPELVAFAACDAPAPPQEDRCHSFSAWSKCTHIPGT
TLYEQTRSCDGMDLTESRFCTPDDEVGSDVSTDVASECGSLGEFGECVNGLQERSYSDCP
DHKEVRQCSDESCSAFGEWSPCGEPQQGLRIRKRRACDNVHCACVEAEVCGDATPEIEEE
EGEHFPPEEGEVLPPYEEGPGEGELLPPEEEIPEGEHVPEEEIPEGEHVPEEEIPEGEHI
PEELPEGEHVPEEEIPEGEHVPEEEIPEGEHIPEELPEGEHVPEEEIPEGEHVPEEEIPE
GEHIPEELPEGEHVPEEFPEGEHIPEELPEGEHIPEEFPEGEHIPEELPEGEHVPEEEIP
EGEHIPEEFPEGEHVPEEEIPEGEHIPEEEFPEGEHVPEEEIPEGEHVPEEELPGGELIP
EEEIPEGEHIPEELPEGEHVPEEEIPEGEHVPEEEIPEGEHVPEEEIPEGEHAPEEETPA
PEETEKEEEEGVPVAAIAGGVVGGVLLIAGGAGAAVYASQGGVEAAEDEVMFESEEDGTQ
AGENRESETVIEIEDDAWADMD
Download sequence
Identical sequences S8GGF0
gb|TGME49_067680 NYSGRC-SEC-TGME49_067680 XP_002368836.1.89292 gi|211966500|gb|EEB01696.1| gi|237839077|ref|XP_002368836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]