SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221053724|ref|XP_002258236.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|221053724|ref|XP_002258236.1|
Domain Number - Region: 2399-2470
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0284
Family Calponin-homology domain, CH-domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221053724|ref|XP_002258236.1|
Sequence length 4409
Comment hypothetical protein in Plasmodium species [Plasmodium knowlesi strain H]
Sequence
MSREVQNKFDLVDVEPKFLEFLYECTDNVETFLENKKNVIKRKRLKIKNICTKTQNIKIC
EPDSKYLKIKGIKNKKLAPGTSEQIFIEFSFADVNFKTSKFVQTDNILDVVNNVESTSYV
TIRSEYTTLNIPIYIKKSIPVFAYDDVINFGVCNANRAYQFALRVKNVGTRRGTFTLSLD
DSPRECSDECADDQQAECAQSRKNSGKFHLRKYRSEDMMIQLDQSSLDLDVGETKIINIS
ISSMAEGKMHKEYRVISNQHSYFVEKQRKITIFAIFTSSHTSFLFNNEKTNLVNLHCLYY
GSRKKYQGKIKNENNYAIFCIPQVDAVNVFYSKEDLEAYAVAKGLDLSRICPDVYLQEEE
HLSEGEKKEKEKLFSITKKRLKGEEHIGITFSRVQGYPIEKLSYQEISFEVYSKCDTDLL
HRLSRDTSYLLNFPVVVELSLRVGRSHRETGQGDSATKQVHSTTKQVHSGTKHIHSATKQ
NHSATEQVHSATLEGAHTLDEEVKICLAFCLTFPCILPSTYLLNYDTITPNEGKTLIIEL
KNRNKFMKLNYTLSKIPYLTLSKSEGVISPQGKVVLSLKLQCDSVKMMDDYMYLYFCNNL
YFIVLLVRGNIISSNALRKGSSSILLNLKAEPFRRNETHGKIKQNHDEVYEQILKNLELE
RVDRNFYQLDGKLDKYKYNERFINFLKKNKKKYNDVLKLMYEKRKKGEESIQNASPSAAS
PDTSEQMVKGKDRLSKILKDKFIYVNDPPVERISNTYINKGVYEQERKKYIQMKTKNLKI
KNEERAQGGEEEEPYLMQFDMLDEEELNKVEFVRMIQYGYIFLGADYTRKFVVFNRNKHC
NVKVALTHGDNITTDGEKILLVGRDSHKMRNVKLNIKCVSREEEVHQDDKNCNDICLNSG
KIGSQTGVSTSFFGEDIITGSCADLHNDFFLLKMFEEKISLMINDSHKREVTLGATLVFL
NVLVNPTTVYFRFHDEDVEMVCERHLVLYNPFNVPLNVGMVCNQAHIALDSEILVPPNSH
KIVPLNFVATESATSVSETIRLYLDGSRLYKSLKCKFIANKCSYRVTPTELNFENILLNR
NYVKEFFLINTGDSPVVFRCNYKPDCVSLLSKYNYVKKNEKVKISVLLNLKEGKKIKDKI
VLTVRGAPQLILPLNVKGTPSNVLICEGIHIQQRRGELKCYEVKILNRGSCDETILVDTS
SVDFLNVQMGNKKETTFSKCISKEYKDANKMEDVVTVQRIYSEEYDDLLTDECAKYHYNN
FLKLHNSISVLYQNKGQILLKDRGEVKSMYRVVVPSKCFLPLCIQCYSSKAIRKEIAFQD
LLHHNRVTYDITEELIKIDIEEGHLDVAPSFLHFTDLIPHQADEAYISYFSKEKTKRITI
RNVFSQPVQWAIRLDEEKRREIHVVTNVHRGVPEFTERKGGMGKSKRMDSVKSRGSSKSH
QTDEPIWERQYQVYPSRHRGILQPNEETTVDITLSGFKLCGRYVDVLDISSSIFSDQNAG
CIDGGNDASNDASNDARNDARNDVSNHASDDARNDASDMLSNLVGEAEPAQKEEAEREVR
FSLYMLICCDIPKLQFDVTYINIIHNKLNDYCSFPFDIYNHGYNYVRVDYHFKNLHAECF
SISLDFINGNEINEQVKKLRMSLKCKATKSLKFKSHIVFTVMDYHQYTIPLFVNIDEGID
FLLEKAATSSSVMSSIEETGEVIDEVVGEVIGEVVGEVIGEVVGEVIGEVVGEVIGEVVG
EVVGEGIPKQMHHMDDYLPPENSPKGASKGTYPAGKPTEGIIMDSSLQQHMNTTDIQFDK
QNELFSFFCKNMEEVKKGSTNGNNIYKGLKINNIRNVYYNEEEEGVYPLREIIGDYLFVF
IQRIMLRKSYFPQVIESTNDLFLFFLDLLLDLFSSIYPNRNLQNIIVELKKRPTVVVKDM
KREDLLDEMFTKNVQTLWKSLKEEEYIPLDHIIYENLLPADLYLFHVLDKVPDYFHVEEK
HYEDNTENLSIKNFESFLLNGNKKVFYFEKIFKTHVRLFSYSWVTIFLEVLNRKMFGAIN
MSSLTNLRGIKLYSIENKLNENIKMYKISYLVILDTEDMEVNKHGSFLNGKKGRSRRKEA
STLTKLHVNRGGTGTRNVAKSSLNTRNGNLIYRDKSTSRGQDKYAYNYVKKKTTKDKPSC
TINYFNFYENNFIDLKKIVNKISRFCYSGGVEELPNGKQETVQGKNELESSKGNTNIEGD
DIPTGGETNTPFKKKSTKEDVKESTIKYSKDTTKDAPNGIVHFKSAECILFEWLYFHYNN
VYHAKVEDKRYIFKEARRKSDDELSYTKGNSNETQERGKPEGSRRKGNPSGSPSFVPSDS
HHVSASGELVPSQVHENTKMSTSNFQVEIKRKKKEVQKKKKAKSIHELKDLVMILYTIIS
HIPYYLFFKKKIKLNCKSKRDYSQNIDVLLIMLSEMNLSNLISRQVIVQFNYMHIYLFLA
SLYFILPKYLPCYYLVLDDLPAYKVDLSWINDEVVNSKKGGKSKPMGKAQQSSRGKQAPQ
KKTNAPIDGENEKTSCGDDQTMADERIITVYNLNSHICKYEVFLIGCNKYQIDRNYVSID
PLKSEQIKLKIDKGYDEKVLKYSNHTSIKLPYFKKKRHKGDMCDGEEPHFEDNYSVSSCS
SEDCQCPSDGADKVDAGIDEDSRVSQGENYTILVLRSESNRLQDEKDSEKYICIKLVELG
EKGKIELAPPGTNIRGEKNEGNNVNANVNNGGTRSEVNKVRTTNSSHLNIMLNDSETKCF
NLRGKVYENKCIELNLFNNTGKEVEVNSNLYHLYVKNLKKEEKGKENFETDVVNKWGDDH
LGGHNQCVVCSIVNANLRNHLSDTSTHFSCVHLVDKNRFTCLQNERKKIQVQFCPFAEGS
YFCFLLFNVNDKKTNYIVSACKVNCSFNINNVKEEEIIKMNSKIFNFSYHLKVCPVNREF
LKCVKFILCNLNHLDERHFLSYLRGYLEDIHKGRKFFSVLCDNEDKISIEKGFATFGPLD
CNKYMEKILYSEGVDIDQLYELVKKETNYTCTLEIAEKTNGVFEYNCALVSHRNVLQGKS
KLSYEQMRKLHIKEQKEICDPFYKVYKIIASVNDGNSSQSLSITFKTSAFQMVKKSIPVY
NYTNGVVTYRRVYSDVIDENNKIVGYNIFSCPEYIEIGKEVESVNFEVSCYSIIGLTCSC
CITLYNVNNEEEQIKINVQANVMKPYPKDTIHLKLLNRTRKTAQIEIYNDLNFHCEFKVY
SDLPILFGVKKIEMMPKQKKTYTFFVTSAHIGEYMGCIIFKHYKLLRSGHGEEKKGDSFF
PFANYFFWYKLNITVELNKPLKILFLETNVGEEVKKDIVLKNNGNENENYFLLAYMNEYI
ERRQVQIPKNDIYVYSIKYAPKIPNYFNEDGNGESASGENNDPTLQRDIQNFYYPHNGDS
DWCGPPGGDEPAHGGKEPWELSPNQGATLKHKHKPFPPTEKKIFEDLISYCNKYIQVDIA
YRPHNIGFFFIYNKNEGINYYILMLLSRMKSHLDVRNFSTCLSKSCFLHLHFQFNEEDER
YVHLLEGMETPPSSNYHYQIVEGVKCPPGEKHILIEENFRGAVDMCRAYEEYDDKWGEEM
QKGNANNYMDAPIYKDNPYNGGARDQVKHELKCIYLSNRNNFHIVKHKDVNRVVLKYRPT
VNTSQECYAIIRSNLHGDFLYRIHGKYTVKRKIKEKLVLYNSCCLYNFNVNLFNPFNCKV
RVKCRFKGGNATQLCNHMCGAQGMKEKDIDEKYMKSFQKERVVLNKERYYLKILNKENFK
IKMRKHFTIMMTYFCKAVYSRRTVLIMMKPFRRDRTHVDGPPMIIYEYDFVFNNFLRSRR
IQNVLQCIPAVGEIKDEQGRGNCDQKQPSTECEDLGVNTSCYFHSSVDEPESGNQASGNF
TMRHSERGDVEANLSEVSDVEAHQSEQSESIHTSRSSSVASERSHFTLNASELGVMDVAE
GDFKLEDADTIEIGKNHTCFTHPDDKALLSPNDYDVEHEIKHERVLPCASDNKEVVHYDG
KIFIESMCKTKTYVEVHIDKTKMGTWASCPQGMPQGMDQLEMQNNSLHRNVEMGNYNYKI
FLLNLKNVRKNMDTVDETVVGGTGGAIGMDVKMNTLLFDVNEGLLNDYLYVHIVEDTEAR
LVLTLELLAFLPFHCSFDVFVSRRGGEGATHHGESGKADQAAATNKAEATNQAAATGQSV
EEAYNVVEEFCGGKPRHRCTTFEQNHISVEILNCMNVSRQYLNITVGDNLCGETRLNIFY
NHTRDSYFDAYMVKHNQLNNSSHWKDEILNFEVKPKCGILKHGSYNKFFITRTNKNGLLT
FNNSFLLLIKTERNVFSYMVFSHYRAAPSDALATEEHNKIKEILNENKKKFSVLFSSFRK
EKKESSIFNQKNQIIIEDISKSTNEIRNA
Download sequence
Identical sequences B3L1K4
PKH_052210 XP_002258236.1.91479 gi|193808069|emb|CAQ38773.1| gi|221053724|ref|XP_002258236.1| 5850.PKH_052210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]