SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221054161|ref|XP_002261828.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221054161|ref|XP_002261828.1|
Domain Number 1 Region: 159-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000878
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  gi|221054161|ref|XP_002261828.1|
Domain Number - Region: 30-108,136-196
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00118
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221054161|ref|XP_002261828.1|
Sequence length 219
Comment Ookinete surface protein Pvs25 [Plasmodium knowlesi strain H]
Sequence
MNTYYSLFVFLLVQIALKYSKAAVTVDTLCKNGHLAQMSHHFKCICNDGLVHISENECGE
KTECKEENLGKTCGDFGICRKGPDAAQQSTYKCDCIKEYTLKDGTCVVDVCLYKDCGQSG
ECIGEFLTEVKSAACSCSIGKVPNPEDEKKCTKDGETTCQLKCNTENEVCKAVQGVYKCQ
CMEGFKFDKEKKECISNSVFNILNLSLFFIVLLVLSYAI
Download sequence
Identical sequences A0A1A7VVE8 A0A1Y3DTU1 B3L272
PKH_061530 XP_002261828.1.91479 gi|193808288|emb|CAQ38991.1| gi|221054161|ref|XP_002261828.1| 5850.PKH_061530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]