SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221057321|ref|XP_002259798.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221057321|ref|XP_002259798.1|
Domain Number 1 Region: 415-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000184
Family Merozoite surface protein 1 (MSP-1) 0.014
Further Details:      
 
Domain Number 2 Region: 369-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000871
Family Merozoite surface protein 1 (MSP-1) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|221057321|ref|XP_002259798.1|
Sequence length 476
Comment Merozoite Surface Protein 8, MSP8 [Plasmodium knowlesi strain H]
Sequence
MKKNAQIIIFFLFGLLSCTCGAEGNVNPPNNNGNKGNGNDNNVPTFIGGNNNNVNDNGDD
IFNKNGKDVSRNDGNHAENPNDKKNENGSGSNEKNSVENADNGSGKSDANTNQNGEDANK
VDEASLKKILKIVDEMENVQGLLEGDYSILDKYSVKLVDDDDGETNKKKMIGEYDLKMLK
NILLFREKISRNCENKYITILPELLKKCSNVDDPKLSKASEKIKKGLTKNNISIEDFVIS
MLEDLFDKINEKFIKDYSFDLNDYLIDFELINYIIMQDTSDLINDLLNMLKSMNFKLESA
SLDKMVKNAQSGMNLNSKMKEDIIQLLKKSSAKFFKIEIDRKTKMIYPVQVTHKGATMKQ
FALNFLEKNNVCEHKKCPLNSNCYVIDGEEVCRCLPGFSDVKIDNVMNCVRDDTVDCNNN
NGGCDVNATCTLIDKKIVCECKDNFQGDGIYCSYSIFNSINNFIFLILLLLCLYLF
Download sequence
Identical sequences A0A1A7VIY8 A0A1Y3DQG4 B3L6Q1
XP_002259798.1.91479 5850.PKH_103110 gi|193809870|emb|CAQ40574.1| gi|221057321|ref|XP_002259798.1| PKH_103110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]