SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221057924|ref|XP_002261470.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221057924|ref|XP_002261470.1|
Domain Number 1 Region: 328-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000436
Family Merozoite surface protein 1 (MSP-1) 0.049
Further Details:      
 
Domain Number 2 Region: 376-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000733
Family Merozoite surface protein 1 (MSP-1) 0.058
Further Details:      
 
Weak hits

Sequence:  gi|221057924|ref|XP_002261470.1|
Domain Number - Region: 53-107
Classification Level Classification E-value
Superfamily BAH domain 0.0615
Family BAH domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221057924|ref|XP_002261470.1|
Sequence length 439
Comment MSP8-like protein [Plasmodium knowlesi strain H]
Sequence
MKRTTWNKSFTFTIFLLLHLNTAVHANGNELKGTDGVDPPKHQDITNDYNTLEHISSEGQ
ISRRNDDSTIPQSNTQQEEEGSDVKEGNTFLHGKNVEKEVETYLIQEEQNKVNHTDLGTG
KQEKASHHVQKNANLRSTSKSSSEAAVNQAYNFVQRNSSPLGKNKANIEQVARAQDDIDT
TENDNTHDTKEHNADADNLNGEGDNAEKGNTENADAKKDNAEDANAEKDIAKNVNAEKDI
AKNANADTGKGGEEHEEPRISPPAEQPTRNAPPLDHAEKIKNRLLKEGRELKETTSMIDN
TVYNVEQIILKTKFYTTAIRNFVLFKVNHICEYSKCGPNARCYIVEKDKEECRCIANYMP
DNSVDYFKCIPKTVKDCSKENGNCDVNAECSIDKKENIKCQCNHGYIGDGIFCVLGSQGK
QSLCLLLLLLICLLHKFLF
Download sequence
Identical sequences A0A1A7W4X8 A0A1Y3DH81 B3L7K2
gi|194247475|emb|CAQ40875.1| gi|221057924|ref|XP_002261470.1| PKH_112880 XP_002261470.1.91479 5850.PKH_112880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]