SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222425457|dbj|BAH20667.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222425457|dbj|BAH20667.1|
Domain Number 1 Region: 1661-1705
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000000335
Family Merozoite surface protein 1 (MSP-1) 0.0016
Further Details:      
 
Domain Number 2 Region: 1709-1758
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000082
Family Merozoite surface protein 1 (MSP-1) 0.0055
Further Details:      
 
Weak hits

Sequence:  gi|222425457|dbj|BAH20667.1|
Domain Number - Region: 109-137,290-388
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000214
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222425457|dbj|BAH20667.1|
Sequence length 1777
Comment merozoite surface protein 1 [Plasmodium chabaudi chabaudi]
Sequence
MKAIGLLFSFVFFAIYCKSETIGVYNDLVHKLEKLEELSVEGLELFQKSQVIVNASSPET
PVDPFADNTFAQKLQPFILKFEELGFTEQTELVNLIKTLGPNKYGLKYLIESKEEFNELM
HAINFYYDVLRDKLNDMCANNYCEIPEHLKINVEEIEMLKKVVLGYRKPIENIQDDLVKL
EEYIARNKATATTLNTLITEETAKITADDEADCNDTTCSTDKYNKKKAIYQAMYNVIFYK
KQLAEIKKVIEVLEKRVATLKKNEAIKPLLQQIEAIRGPTVVTEGQIATEGSSEETKQNS
TESSNTKTTTTDKAVTTQTATKATGTETNAATGTNTATGTTAATGTTAATGTTTVTEAVQ
EPVVKVLTEEEKAKKIAELYAQIKEIAKTIKFNLDGIFVDPVELEYYKKEKKNESCHSTS
SCHKNKTPETVIPLNVRYPNGISYPLPEEVVYSKIAHNAAETTYGDLTNVDDTAITEDLT
TNEQARKNLIKAIKKKIEAEEQKLVELKADYDTKLAAFNGQKTPFKQAAKNFYESKFRNK
LTTEIFDDFKTKRTEYMNKKAALVGCEYGNTQQLINKLNKQLNYLQDYGLRKEIVNTEIE
YFSNKKSELQYNINRLANAVQAKQNILVASKHIPLSTLVELQIQKSLLTKLIEQLNKTEF
SLNKAHLKDKIYVPQTYGKEGKPEPYYLIAIKKEIDRLAKFIPKIDDMIEKEKQKMEQEH
VATGESEQASSASGTGSSTETTSQTAPAVPAAPAPAEKAKEGTESTEETPAASKPAEGAA
STGATTPTEQEAAPTEQEAQPAAPETPAEVPAPTTPAAPATPAAPAAPAKPVMTKLYYLE
KLKKFLAFSYACHKYVLLQNSTINKDALSKYALTPEEDKIRTLKRCSELDVLLAIQNNMP
TMYSLYENVVDGLQNIYTELYEKEMMYHIYNLKDKNPAVKALLVKAGVIDPEPVAPTPAV
PAPETAPETAPETAPETPAQEAPQQPESAQAPEAATETTTPAESASTEPTPKAPTATPTS
ETVTQEGTTPAAPKAQEGASSSAPAQPAPAKPAPAQTVTGQSTNVEGSTQVRAESEDEMF
VDDFEVDNFYKSYLQQVDGNNTQFIDFIKSKKELINALTPEKVNQLYLDIAHLKELSEHY
YNRYYKYKLKLERLYQKHEQIEAANQKVKEISVLKSRLLKRKKYINGTFYVLSGFANFFN
KRREAEKQYVDNAIKNTDMLLKYYKARSKYFTSEAVPLKTLTKTSIDREANYLKIEKFRA
YSRLELRLKKNINLGKERITYVSGGLHHVFEEFKELLKNKGYTGKTNPENAPEVIKAFEQ
YKELLPKGATTPAPVVAPVVAPAPATAAPAADAPVPAAAAASGSGSAATTEGEAATTVVA
SSDNDDDDDDDMDQIANAQSTDEEVKDILDAFKSENEYIYTKSLGNTYKSFKKHMLKEFS
MIKEDIMTGLNYKLEKRNDFLDVLSYELALFKDINTNKFVVKNPYQLLDNDKKDKQMINL
KYAIKGVTEDIETATDGIEFFNKMIELYKPQLNAVNEQIAAIGTEPTDAEKKKYAPIFED
LKGLYETILNGAEEFSELLQHKLENYKIEKAGFDILMANLETYIRIDEKLEDFVESAEKN
KHIASIALNNLNKSGLVTEGESKKILAKMLNMDAMDLLGIGSNHVCISTSTPDNAGCFRY
DDGTEEWRCLLGFKKDDDGNRCVADDAPVCNNNNGGCDKNADCREVENTDRDPSKKIVCT
CKEPNPNAYYAGVFCSSSGFMGLSILLIITLIVFNLF
Download sequence
Identical sequences B9A1D3
gi|222425457|dbj|BAH20667.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]