SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23494961|gb|AAN35295.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23494961|gb|AAN35295.1|
Domain Number 1 Region: 8-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000181
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23494961|gb|AAN35295.1|
Sequence length 213
Comment mitochondrial ribosomal protein L22/L43, putative [Plasmodium falciparum 3D7]
Sequence
MCSNGVYQLKNILLRYSETGHSSRNVRFFLRYLLPEYKEENKHLNFEIHHEQYEEPKVIF
EYINNTKYEISLKDIKSKHIVDIINLYKDSAGNNDYLKHGGPKVYSNRRSIQGLWCPNIY
SELNAISYLKKKKKNNIKLPKYTRESLNLNHDVIKGYGRWGNENLFPKGFDQRYLKNIFC
FPFKDSLPKKMEQNNAVESKEAEINSFYKFYKN
Download sequence
Identical sequences A0A024V727 A0A024W8F6 A0A024X776 A0A0L0D3G9 A0A0L1IDS9 A0A0L7KDD2 A0A0L7M279 A0A2I0BQG8 Q8IJU5 W4IHZ2 W4J2S7 W7F759 W7G5J0
PF10_0097 5833.PF10_0097-1 gi|124802149|ref|XP_001347382.1| gi|23494961|gb|AAN35295.1| XP_001347382.1.26446 PFDG_02827T0 PFHG_02668T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]