SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23496937|gb|AAN36488.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23496937|gb|AAN36488.1|
Domain Number 1 Region: 39-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000155
Family Thioltransferase 0.066
Further Details:      
 
Domain Number 2 Region: 365-444
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.00000889
Family FAD-dependent thiol oxidase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23496937|gb|AAN36488.1|
Sequence length 531
Comment conserved Plasmodium protein [Plasmodium falciparum 3D7]
Sequence
MKVTYAVRLLLPVYFLFFWIHLNIVRSDNVCKGADVIVNEFWSKLNNIRHGDVILINIKN
YYCPACNRYMNIWNDVEKKILTYEKNVSLFVFDCSCYLLVPYCRYFDVLYFPTFRLLFPV
YDKINDKEYKYINPSSMIEGEKYNGDLLLAYREVERIDNIYDFKILIEKYLCKNVNFNYN
DLRICMNSSYILPEKKNKKKNEIYHFLFGYKNDKNKEEIKDSVNVMNDDFIENNYDYEEN
KENVERWSNHINFNKDNIKHDIIIGILFTLKKHISLGRDIQKEYIEPFLVMLSIVSNIYN
DLEEGLYDIINKLNSFTYPIKYDEWIKYTENINYINEYKLDYNNNNNNDTNLISFKLCEQ
NSVLCSYWLLYHKISVYCLQHDKHNYLYYIEAITNYTKNYLNCQNCIDHFLNAQKFCYYG
YCNIHSAESFIIFLWRIHNAVTLRSMYDLLMIDNNTSTPSNNFNKKQFLNQDIVFPTLKQ
CKNCRNALGFTKITNHTLSTFKNGSITDQSFDAIDSFSVKNVLHYLIHIYS
Download sequence
Identical sequences A0A0L7KAP4 Q8I509 W7F8B8 W7FEA4 W7KC14
PFHG_02138T0 PFL2020c gi|124806715|ref|XP_001350808.1| gi|23496937|gb|AAN36488.1| 5833.PFL2020c-1 XP_001350808.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]