SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23498305|emb|CAD49277.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23498305|emb|CAD49277.1|
Domain Number 1 Region: 480-781
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-52
Family Duffy binding domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 204-449
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.46e-40
Family Duffy binding domain 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23498305|emb|CAD49277.1|
Sequence length 1388
Comment erythrocyte binding antigen-165 [Plasmodium falciparum 3D7]
Sequence
MRKTLKLFYISGFLFSSRALCKLENYIKNEYDRENSFYILNNKVEKEYEKGTNNNINIDN
KKEALLEDKKNVDNKDIKEQLPENNKNFEEKILHEDICKLNKENIEKEGLYKPNTFKSIG
NDLLYKKGKLNFLYEYGMELLHINKVPMNRMNNSRGLGDSNMSFLDISNNNMNSLNSMNN
LNNSNNFDSSNSLSFVDMKSIHRCIKKRAKGERDWACNDKNTKEPNICVSDRRVQLCTGN
LIELPINDSTKEKFKEKLILAAQKEGSLLFEKFGKKYNEEFCLNLKWSYGDYGDIIKGTD
MEGLGRSIKVEFEIDRIFKRDNKKSAENRKKWWEEISTHIWNAMIKEHKEKFPKDVKECS
ADKPLDEPQINRWLMEWAYDTDYNKNLWYNKLDDSKNKCNRICPKKRNFSLYKTAFEYLK
QKWDKYKELNFSSIFDQLNAKYYNKCICQNNKIENNALYVKIEDICNNTKVKSIYGELYC
KEKGNDKIWQCINEHIKDFPDVCGPPRRQQLCLGNLDKDEFKNVNDLKKFLNEIILGIRD
EGKFLIEKYRKNMHENMYLDERACKYLNYSFDDYKNIILGKDMWRDPNSIKTENILKGNF
EGIKANIVSMYPSYADLSLDEFRKHWWDQNKKQLWEAISCEFYKGNHTGVCLMEDDNDNQ
YLHWFREWKNDFCIDKLKWNDVIKEPCIDKKVKSPKPSENPSDVATVCNKSCTDYDKWII
NKRKEYKMQSSKYKRDRSLFNNVIQNLKPWEYLSMKCTECTCNLDTQTFVYPYKGYEDIC
KSTVKPYDPEDIKDEEFNEPSLNVNPLSLTSQDVTERVSSVDDVLSIKENVDLKPFKPKG
GTQSSHVDQVGNPRESESKPSGANGREDPSTESSTYNDGVITSSSSLGSSSGRDVSSSPV
GVGDEHEAKELLPPQKIIDGVTQSDESTLSQHGKESSQEQHNLDGSSLSRHSNQDEERSI
ITSDVEHGTNSLFGSQIQDQETILGESEPLTTSPPEHETSKMDTHAGGKNMEQVRNASVD
SSSEMSNGGRGGLKTKEMKGEEVTGITSKNDINLEDSTVHSRQNKIENSGDNTQGKEHIN
VLQGMDKHLENPPTSERGDSVLESEFSKLNRTSHTHDNNRIETTAENNIGGLSNSNVHDG
RDSQRNRMHINSRSRHGSLESDIVVRGDDISNIEGGEEEEEDANTLKYPRNVLNNKNSRT
YNIEEYIYRDVNKVADDIMRSYKSNRCTNNLSSNYCSKLKKESLSNTCTNEDSKRLCCSI
SDYCMKFFNFNSSGYHSCMRKEFSNHAYKCFAGKGFSNMYYFAGGGLFFIILFLLGAKSS
ILNWSEDNELNGTAFEEANFEDAAFEVTTGQDSAFEDYDENAYRIGLLMNQKIQSAKSSD
YLEYHVDN
Download sequence
Identical sequences W7KBI7
5833.PFD1155w-1 gi|124505609|ref|XP_001351546.1| gi|23498305|emb|CAD49277.1| XP_001351546.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]