SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23504510|emb|CAD51390.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23504510|emb|CAD51390.1|
Domain Number 1 Region: 536-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family Merozoite surface protein 1 (MSP-1) 0.027
Further Details:      
 
Domain Number 2 Region: 489-523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Merozoite surface protein 1 (MSP-1) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|23504510|emb|CAD51390.1|
Sequence length 597
Comment Merozoite Surface Protein 8, MSP8 [Plasmodium falciparum 3D7]
Sequence
MVFKSSYIFFFLFLVILYFNNVVEGENGTTNIENNPGNNGNMGPSGPKDKDKNIEKDVNH
NMSMNNNNNNNNNNNNNDNNNNINNNNNNNINNNNNNNNNNGNGFSNFFNKLFGKKKDNK
KEGEEKNEEDLNSNKNIESNKGSAVTSNVGDTNNDAKARDNNNNDDNDDNDENDDNDDND
DIDEIDERDDNDDNGDDDDDNDDDDDNNDNNNKNNSNNLTDTKKEGEKIDLGVQNKKQNI
FSTNNKGLNKYNIDNELKEVDALLKNDNYILNKYHVSFFNNFEEDTYNKKKFIRPYDLSL
LKSILIYRQRVTRNCVNVFQDFNAVFGKCYNKDDTKLSITRDKVKKELSRKNRNFVEYLI
EMLENTLNSMNDDFINKDNFDLNNYVKEFELINYLLIHEDSDIFLETYNLISGLNSNIEE
TSIEKLKYAILQGKQINYKIKDDIYYILKNAYAKYFKIDVYKKGKLLYPTLYYHRNAFIK
SFVVEFFNNNKVCENTKCPLNSNCYVIDDEETCRCLPGFNNIKIDDEMNCVRDDTLDCSR
NNGGCDIHAKCSFINKQIVCECKDKFEGDGIYCSYSFFSSIHNFIFFFILCLFIFIL
Download sequence
Identical sequences Q8I476 W7KBC7
PFE0120c XP_001351583.1.26446 5833.PFE0120c-1 gi|124505971|ref|XP_001351583.1| gi|23504510|emb|CAD51390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]