SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23505093|emb|CAD51875.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23505093|emb|CAD51875.1|
Domain Number 1 Region: 43-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.42e-16
Family Glutathione peroxidase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23505093|emb|CAD51875.1|
Sequence length 207
Comment thioredoxin, putative [Plasmodium falciparum 3D7]
Sequence
MACVNFNSPYQAEKRRTSENADNCKLETLNMPINYSDMDLILFPEGSLKNINNTVVNEKH
LFGKSVAIFFSNGSDPKCRAFLPFLQQYYKTINEGGSSQKIEVIFVSIDPDRKSFEDHKK
HMPWLYVDVADPLTDILKKHFRVTNSHEVPFYGSGPRSDVPCLIVVGSDGRESQLLHICS
GRDEGEKGLLRWDFRNNIYTPNKKETC
Download sequence
Identical sequences A0A024V6Y7 A0A024W800 A0A024WS65 A0A024X845 A0A0L1I604 Q8I2W0 W4IHL0 W4J0G8 W7FFZ9 W7G738 W7K816
5833.PFI0945w-1 PFI0945w gi|124506934|ref|XP_001352064.1| gi|23505093|emb|CAD51875.1| XP_001352064.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]