SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|237836759|ref|XP_002367677.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237836759|ref|XP_002367677.1|
Domain Number 1 Region: 1410-1477
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000497
Family HMG-box 0.0024
Further Details:      
 
Domain Number 2 Region: 1127-1195
Classification Level Classification E-value
Superfamily HMG-box 0.000000537
Family HMG-box 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|237836759|ref|XP_002367677.1|
Domain Number - Region: 2343-2387
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000187
Family Myb/SANT domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|237836759|ref|XP_002367677.1|
Sequence length 2518
Comment myb-like DNA-binding / high mobility group box domain-containing protein [Toxoplasma gondii ME49]
Sequence
MPPGVSPSPNPSLLAGVEGPCPSSPDSRRTDASPVTFSFTYPSPSALFDPEKENESSYAP
CSSLFSAASHTHVPVKPGVQFDFDSSSQPSHLSSFAAPSLSFFRSCWRDVPGRKPAEEAQ
TVPVSSLPETDLFAPLALVASRASGCSSQISANAKVACKNSKGRLRGGADREEATDTAVS
PVSGILTAGPKEGSLPAGTRPRDGIAAGETVSLDQERPCSSSRPPLSALSLLFSGQSSRR
PRESGESLESVAPVCEAAFTFSSPLSVLPPAATVAGACTLTQGGSAWGCRPSGEDFPLRF
IPLLHAEPVRGGVEQAVPLDPGPLSWSSCPFVVDPLAFSLSSTLGDGVICSSLSADPAEA
LQTSAAALATALKFAAAAALCSPKKRASGAASKGSVSPLHPDGGEREREKELAFFQAFLR
ETQLRRRRARQARREEETSALMPLGAATAASRKQHDDLYQAFHAAHRVAESWAERLSKDV
DFFGSRSARQVSCGESEAHASFAAYKKETTSPAEKREGETLDCDHGSLQASRESGQTAQD
GLQVLVEQWGTEIVGRVSDKIPVGNIEQKETRKPSKGLDLECAFPAVKLSCRPSSAARAV
LYKALRGVANELTQAEELATHLREKTEPSSSATSSVPSPGAVPEEGDLAETKSSGSSAAS
YAPPAASDGSGPLSSQAPAFQAGDEESTERESDPLAAGVERGSASSFNFLEEAEEAEEAQ
VQKLVKRAMLLRSLRDLLREHLSVSLPSGAPLSLSPTKRDPPSGPSSPAAAGPSAPASED
ATSDFFSEEKQRHERILSLLLRQVERHEDRQVHELLLSTSTPKPVKQRLVQVLLAEVLAE
VSVTFHHERLRKLSPSVGSRKPSHGTLSMPVASERGRACLTSAGAAPASGKPGTQPGVSG
GPLAPASSPAGEGVLPAELAGPSPLSILQCLVRAQRAEAATAEVQAEVVAAGRAALLRLA
HLAPRLAACIPLLAPYLNHLPRLLHVQLQLLAQQAQRGELTTKGIEEKLLKHFRDQEAFA
CTPFFAALSQQLAECLAGSRPILPAPSLATVALAPGAATPQTLASGLLAPGAAAGPFFLA
QGAGGERGLASVGALAPRLAALGTAREDGKAANTPGGLAGKPPASAAAKKPSRKGMGMSG
WALFAKEKRAELQQEGTLEGETLPEQTSFVARFWHQLSKEKKAEWGRRAEELNRQAGLRM
KKEEEIRKMKEQAEAEEKKRAAAATVTGLSEAGLGGVPLQGPSGSLPQLKPVLGAPMLHP
SLAPFTTAKNTLPGGAYPHPGPDDRAHQSLLPAGTPAGPATRVVHADGSVSFVGHTVSGA
SPSPAGGLPGDGVSPRAAQAGEEASQASSGFARTPQPQGLATPFAVPGPLARPPQPPDGM
QSGVGADFPAAKKKSRSGGSGKKGEGQGKGGRGYTAFTFFAKEMRQKCKEEGIECGTSLS
EQNTFIGDKWRQVSPEEKKIFQQRAKEANEAWRREHEEKLLLAQQKEQEQAQKQDTPADP
SLAFAVPQAGATPSAGPPQMSAQAAGQLRSSSLPGSVACSLPVYGSPPQTGAYQLATGPG
HPTPSQGAQGGYPPQGPALQERRGEREGDAFGATASHLGLPHTVSGPQGRAPPESRGELG
APAPLPALHRGSTPFSGSPSSASLSAHAVAREEDGSRERVSALDSASPPLKKQRGDSEDA
PFFSARPGPGDPASAGAGRGSEAGEVHAGERERRGFYAAAPLPSNAHFGETGCPSVGDQD
GAQRAEGRGAVGAVATPEPQWRREDDAFAVQSQLPAAQFTPPPASLPALPPRTSPFPCDH
TVGLRKPSLSAPPSAPGLGGLAAYPPEEVLYQLKFDSPLDVEEGRRDEDREERGRKMYGG
GDRDASDRTDFFVSEQVHSAPLPSRRSLRAAARGALEKGSSEGTGETGKETKGEEGVDAS
ENEESEGDGAANSKEEEERDAETGDEERGARQGLRRDEGRRGRRGDHLTGGSAREEQQQV
ESPSSGRFGTRVRRGVSDRDGLRFEETERDQDEGDAETEEKDEEWEEEEGADDSSDEDFE
PASRRHSASAKKRLRKVPLPAAVEETGETPDPVRASGRAQRRSGGAARESKGAADEETEV
PARRNQGSRRKRTGSTERSKARARRRREEGKELLQLSLPASIVEKEGPLTLWDLIQRNKR
KPVSSAKGEQEAEAKAKAGASGENGGRDSQRHGELDESFDSVLGSLFSAPASFGQGTLGG
GDQALQALLSPSPTRKGRDEEEEGSAEKDLSALFDTPRQGSAPALRLDADGQLVMDERGE
EMEPPVCTCGASLGLFDALGQASAPCVCLFNGRRRLVEEGGPGGVNGLSLQPYAGAYKST
KGKRWTPEETQRFYAALEQYGTDLLLVGTLLPHVTDKQLKLKLKIEERRCPEKVEAALRR
RRQLTTDAYEGMHGKINAALHYRRALGSSSSDDSDGESETRRPKAIADSPPISEPTLPSA
PENSSSSSFPALLSILADASADGQTAADNTDVDPSLFALPVEGDITAGAGDDLLALFG
Download sequence
Identical sequences S8F903
gi|211965341|gb|EEB00537.1| gi|237836759|ref|XP_002367677.1| gb|TGME49_003950 XP_002367677.1.89292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]