SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258597440|ref|XP_001348162.2| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258597440|ref|XP_001348162.2|
Domain Number 1 Region: 3-245
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-41
Family Duffy binding domain 0.0000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258597440|ref|XP_001348162.2|
Sequence length 6093
Comment Antigen 332, DBL-like protein [Plasmodium falciparum 3D7]
Sequence
MSNINNKDSSTEWNCKEDVGCVPPRRQNLNMERLDNENEDSVPDFMKKTFYLAAAGEGKK
LREKHDESCDEFCDAWNRSLADYKDIFQGKDMWNDGKYGEAKNHIKNAFGDMNNRKTMLN
EIEKGIKDETFSRENGLDVCKSQCEERSRDDTEDQFLRFFAEWEEEFCDGLNKHEEQLKS
CTKDINCDIKCSNFKDWLETKKDEYDIQSRVFEKKYANDNKSKHLNYLKEGMNKCKVKNP
EMVFKSGFANVAECRNLNVEGAGNKNSNNLKDLDSNSDKDGIVSESYKATKKNGESIMDR
IPKSFNKLFGYFSGSQEEEQKENDVSHRNNYDNILVDKFHRSSLLDKLDDRMFFDELNRD
NIMEEVLSKIPEPIIREAPKYVPKKPVPPQHIPRGDNVPRNIDVNGSKDEYSPETESANS
KIKPTYEENDEDKSKISIETSEIDRDKEPFRISEEKKVVKEDVQELENIEYEFDETFDFF
DEDAKRNIDDIRKDIQSQIMKSVENYNSEKEEFKRNIETQLIESGDGMNAGNYSSALQDN
STEIPTMVLVPGVLTVFLLTIIWVLVYKHSLIDRVHGTGKTKKEEKMKELESEEFPKEKY
NIEDMEETEKENEIEKIMDENKETEQTEEGNTEEFVQEKELNQETLENEIIVDHIKEEED
TRNVKEQESVLEESPIEELPVENNIGKINEEVEEFILNEIPLEEQVPKELPQEEIEEIVV
EELPIDEHLSSEETTVTEEDTFKGQLINEEKPVEEKSVSEEIPVEEKSVSEEIPVEEKSV
SEEIPVEEKSVSEEIPVEEKNVSEEIPVEEKNVSEEIPVEEKNVSEEIPVEEENVSEEIP
EGGIAIEDVPVDEETVTEEITVDEKIYDKLPNEIETVNEEMPVEDETLTEQISSEHERVP
EEIIEEKPFTEGEETESLTDEIVEEGVVTDDIPEEQIITEKVQEEEEFVTGELSEEDIIN
EKVQEEDESVTEELPEEDIINEKVQEEEESAYQEIVQDGSVTKDVEYKELVNDDVRDKEN
FVIEEDPFKGQLINEGLPVEEEFVTKELPVKEESVFEELTEEDQSVTKEIPVEEHSVFKE
VDEIESVTDEIVEEEGSVNEEVEEEVSVSGEVDETEYVTEEVEETELVNEEVLKEEGSAS
EKVVKEEGSASEKIVEEEGSVTEETASEEIVEEEGSVTEESSSEEIVEDEGSVTEESSSE
EIVEEEGSVIEESASEVIVEDEVSASKEIVEDEASVTEEVVEEEGAVSDEVQVTESVEDE
IINQGIVDEVIVEQEASVTDEIVKEDESVIEEIAVEETVTEVVEETKPMDEEIVDQGSVV
ENVEEKKTMDEEIVDQGSVVENVEEKKTMDEEIGDQGSVAEKVEEEELVTEEVIEREGSI
NEDIVKEASITEEVEQIEPVTGKVEKIESITDEIKEQLVPEDIKEEQLDFEEIVAQRASV
NDEKVEVASITEEVEEEEKSVSEEVLEEEGSTTEKVVKGSSTEVVVEEQGSVTENLLEEE
SASQGIVEKEEFVDEEDSVKDQNVFEKEGSVTEQLVEEEKGLINEDNEKEELITEMSEEI
KSVNEEIEETDLSTEEIIKQQGLATYEFVEEEKSLTDKLLEEESVTKEVGETELSTQEVV
DEKVSVTEEVIEEEKSVSEEVLEEGSATEEVVEEGSCTEVVVEEGSCTEVVVEEGSCTEI
VVEKGSDTEIVVEEGSATEIVVEEGSATEVVVEEGSATEEVVEEGSVSEEMLEEEGSATE
EVVEEGLSSDNVQKSKGVIENVGEIYSVKTAKDESMNEKIPLEKSSFVDDESFKGQGPTD
NVSVEDVNSEDIINEHTPLEETKIEELPTEYITTADIHTKGETETKYNLIYEKINEEVEK
AKFQEEKITENIPVERESVTEDIVQEPSLAQEVEQKESDTNEIEETKLANEKIIPEVSVT
ENVVEKEGLDTEEVLEEDESITEEIVEEEVSSSEEIVEEEESSSEEIVEEEESSSEEIVE
EEESSSEEIVEEEESSSEEIVEEEESSSEEIIEEVSSTEEVLEEEGSVTEEIVEEEVSTT
EEVKDIGSVSEEVLEEEGFGTEEFVGQQGSVIEEIVETESSTEKVLEDVGSNVEEIVQEE
GPVAQEIVHEEVSTTEKHDEVDRSTTEEIVEKVGSVSEEIIVEEVSASEEIVEEGSVTEE
VVEEEKLINEVGETESVTEEIVQKEVSDAEEVLGQEGSMNEEILEKESIVEEIVGPEGSV
TEEIVDHGSFAEEVKEEELVTEEAVQYEGSVTEEIKEEESITENEAIEESAFAEIIEEKG
PNTDEIVKEEGLDTEEIVNEVSVTDEVIEEEKLVNEQIVGEERSVTEKPVEVERSATEDL
VEEEASVTEKVSVHEGSTTEQILDESVAEEIVEEEVSVDDKIIEEEVSVDEVVEEEGSVI
EEIVEEEESVPEEILEEELSGSEEVLEDEWVTDAFMGQEGSVIEEIEEIVDGEGSITEEI
VEDGSANEKIVEEEPSRVEEVLGKEGFVIEEIIEEGSVIEQVEDTKTVSEKSEESSAIEE
VKEVKEEESISEKIVEKEESVTEEIVRQEESTTEKIVKDVSPTEDFVEQTDSVTEKVIEQ
EGSNTEVAEDVEEKESASDEHEQEDVSVNAQVTYEKKSVTKEIVDEVSRTEEIVEENGSV
TEGVDETGSVTEEIIEEATVTEEVVEDGSVTEEVVEDGSVIQEVVEDGSVTEEIVQENGS
VTEEIVEEEGSVNEEVEEEVSVSGEVDETEYVTEEVEEEGSVVEEIVEEEGSVSGEVDET
EYVTEEVEEEGSVVEEIVEEEGSVSGEVDETEYVTEEVEEEGSVVEEIVEEEGSVSGEVD
ETEYVTEEVEEEGSVVEEIVEEEGSVVEEIVEEEGSVSEVVDETELVNDEIVEQAPFTEE
VEEQVSVNDEIIEDASVAEAVEESESITESVSQEEETEKGFVIEKVEETGAVTEEIVQDG
LITEEILEESESVNGEIINKESDAEEILETEFLTEEVVGQAGSTSEEIVEEEGSVTKEVE
EKESVTEELVDEGSVTEELVDEGSVTEEVVEQGGSIAQEIVEEESATEEIIRDETNVEEV
LEKEGSATEEIVQDGSGTNDFVGKQGSVIEEVVEEEISTTEEKLKEEASAIEEFVEEESI
REDVLEESLVTENVVGQQESVTEEIVDGEGSFTEDIVEEEESVTEEIVVDEESVTKEIVE
DEELVTEEIVEDEGSFTEEIVEDEGSFTEEVIEERSLIEEVEDTETVAEKEEGSVIKEII
DEKSLTEKIVEEEKSVTEEVEEKESVKEEVEEQRLVVEEEGSATEGIVEDRLATEGIVDD
ILVTEEIVEDGLATDEFVEQQGSIIEEVLDDEGSVTEEIVEEEGSPNEEIVEGVSVIEED
DNIEPVSEEIVEGSVTEEMIKEGLENEVILDEDSITEEALEKEGSVSEEIVEEMGSLTEE
IVDEERSTSEDMIEEGSASEEIIQEESQVEEVVEEVSVIDEIVEEDELDTKEVVEEIEFN
TEEVVEHKEEEGSVAEEIVQEEKEGSVNEEIIEEVGSITEEMVEQDVSDNEEIVEERSVI
EEAEENVWIEKEVEEEGLDNEEVIDEEDSVSEQAEEEVYINEEILKESSDVEDVKVENEL
MNEEVNEETQSVAENNEEDKELDNYVVEETESVTEEVVVDEVPNSKEVQEIESIIEEIVE
DGLTTDDLVGQQGSVIEEVVEEVGSDSEEIVEEASITEEVEKKESVTEDILVEESVTGDI
LVEGSVTEEVVGEEKLVSEEIVTEEGSVAQEIVEEDAPATEEIDEIESVTEEVVEEEGPV
DEEIVQEEGSVTEEIIQGESKVEEVVEEQGSENEEIFVEEVSASQEIVQNESGTEEILEK
VSASQEIVQDGSVTEQIIEEQKPVTEEVVNEEESITHEIIQEESHVEKVVQQGSVAEEVV
ENPVSVTEEIVEKEGSVTEDIGQEGYVAEEIVEEEEFDNEEILEEESVAEEFVEEGFDNE
EIFVEQISDSEIVKEENSVNEEVLEEEGSYTEEILEEEGSYTEEILEEEGSFTEEILEEE
GSYNEEILEEEGSYNEEILEEEGSYNEEILEEEGSYNEEILEEEGSATDYFVGQGSDNEE
IIEEGSATDYFVGQGSDNEEIIEEGSATDYFVGQGSIIEEVLEEEGLDTEKVFENEGSAT
EFEETESFTEVVEETESVNENILEETSINEVQKIESITEDIKEQLVPEEIKEEQLDSEEI
KEEQLDSEEIKEEQLVPEEIKEEQLDSEEIKEEQLDSEEIKEEQLDSEEIKEEQLDSEEI
KEEQLVPEEIKEEQLDSEEIKEEQLVPEEIKEEQLDSEEIKEEQLDSEEIKEEQLDSEEI
KEEQLDSEEIKEQKGSVNEEVVEEEGSVTEEIKEQEESVNEEVLEEVEETESIKEEIVEG
GIATQEIIEEESDTKEVVEEEVIDSEKLVDAGSVTGEVMPEEVSVTDEVVEEGSTTEEVL
EEQKSVNEEVVEDGLTIDDFVGLQGSTTEEVVEEDGSAIEKILEEETATEEIVEKQVSVT
EDIVEKEGSVNEEIIEEASVAEEIIQGGSFTEEIVGQEESATEEVIDEEGLISNEIEEEE
EKSVTEEMIEEVEEVSVDDEVEEVSVAEEIVEEELVDDEILPEELSATEDVIEEVRSVTD
EIVQEESVCEEILEQEVSASEEYVDDKSVTDDFVGHERSVIQDVENTESVTEEIAEVDKS
VIEEAVEKQGSVTEEKVQEGVSAIEEIEELESVTEEIAEEDKSVIEEAVEKQGSVTEEIV
EEEELDTEEVLEDKSVTGDVVEQEGSGKDESEAKESFTEEVDELKSVKEEDQETEYISRE
IEEESATEQHSEQELSINKEVVETESLTKDIEEEKSTTQEILEETQSVNEEIVEEERDTD
EVLKEKVSPSEEVIEEQASTTEEFVEERSSTDEIVEVEDLFTEEVKEREGSVTEEIVEEG
SDTGEIVEEEGSDTEEILEEGSFNEEIVEEEGSITEEILQGSVTEEILQGSVTEEFVGQQ
GSVIEEIVETESAIEERVEEESATEEVDERESVTEVVEEEVSSSDEVVEGSIEEVIENEG
SVTEEILEHEVSADENFVGQAVSVIEEVEGTESVTEEVVEETESVSEEIVEVSPTENVVQ
QTDSVIEEVVEQKEGSFNEEIDIRELGDDGVEEREKISTEEVVGQDKSATGDVEEVSSTE
DEEEVSSTEGLEEVSSTEGLEEVSNTEDVEEVSSTEDVEEGSVAENVKETKSITEEVSVE
EDIITDKVSVEQEVMAEASVEENILTEVPVEEEIMTEKLSVEDKALNEKIMSEEEIVIED
GNVHEVVPAEVSVTEEIPGVEETTNNESHVKGENVVNEVVVDDNSVNDEIQFDDDSSIEI
YTVDSKDVFHKEENYDSFREEVRSDENIHIFRKKNENFVKKIENEKSSVGHVPTEYTSKE
NIAEEVPSHIMFKENVTEEVPKEVKYEENTVEEVFEEVTSKENIIEEAPGDINSEENIIE
EVPEVVTSEEIVVQNDVNNINTNIDHMFDFDLDDILKIPEAQRKLNKLRTLVDVHLDVIE
KMQRDEWKKNKRDFLYICLKEINKLSEDTLMKFYGSDSNKSANDNDTVMVIKILKDKWGT
GRIVDTIANSLNKSYNSLYHNLYIEMEKDLLINKTETFNKWSKQHWNKLDNWKEEKWFKL
FKRDLKIDMRNTYESDQNDEENNEESMNELSDELIKNNTSDNMRNEQKTLEKNKEYSNLS
KDLGLIEKQKIIWKSWIVKNVNNIENWFDEMWFKNVVNELKEKNDVSNVLQENASEASVE
NYISDVEDSKDMTNSINDSEKSKIVASSSKTTNEEYIILSRKDLIYNIIVMVHMMVLDQF
KYDELKYAKKRFLNRSIDKFIKEKKIKDKETVLDYYIDDIIKRIVEDTSHVNNIKEKAID
HYTSHDWFRLLRQGNKAQNSISQEVDILTEKYKKLISEEDNKKENNNNNDDEVKPELKDN
IKCEENVSFNILRRSNKKDQLPLEEKKNKNGDLNNTLTESDGKKININEAIEESKNGNED
KNSGNMEKSRKPRDRRTERKEKDQDLRVQLLQDYENIFEQIQNMENQNKDKNKKETKNIL
KTSIDLDKNLLREYKKEKNIINQSEKEFSVNEN
Download sequence
Identical sequences A0A2I0BVN3 Q8IHN4
gi|254832737|gb|AAN36075.2| gi|258597440|ref|XP_001348162.2| PF11_0506 XP_001348162.2.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]