SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296005251|ref|XP_002808957.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296005251|ref|XP_002808957.1|
Domain Number 1 Region: 21-125
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.63e-26
Family Thioltransferase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296005251|ref|XP_002808957.1|
Sequence length 128
Comment Tlp2; thioredoxin-like protein 2 [Plasmodium falciparum 3D7]
Sequence
MFFLQNLKKITHPKYLCTTIRRNVYTELNKIDDYLSKVNGNKLVVAQFGASWCAPCKKMK
PVIEKLGEDNDNIESLYIDIDEFPELGENEDINELPTILLRKNGKYLDKIIGMNESDLIK
AVEKHQSD
Download sequence
Identical sequences A0A024X8S4 A0A060RXI6 A0A2I0BSV2 C0H561 W4IIG0 W4J0S4
gi|225631843|emb|CAX64238.1| gi|296005251|ref|XP_002808957.1| PFI1250w XP_002808957.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]