SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|3845149|gb|AAC71850.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|3845149|gb|AAC71850.1|
Domain Number 1 Region: 210-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|3845149|gb|AAC71850.1|
Sequence length 272
Comment merozoite surface protein 5 [Plasmodium falciparum 3D7]
Sequence
MNILCILSYIYFFVIFYSLNLNNKNENFLVVRRLMNDEKGEGGFTSKNKENGNNNRNNEN
ELKEEGSLPTKMNEKNSNSSDKQPNDISHDESKSNSNNSQNIQKEPEEKENSNPNLDSSE
NSSESATRSVDISEHNSNNPETKEENGEEPLDLEINENAEIGQEPPNRLHFDNVDDEVPH
YSALRYNKVEKNVTDEMLLYNMMSDQNRKSCAINNGGCSDDQICININNIGVKCICKDGY
LLGTKCIILNSYSCHPFFSILIYITLFLLLFV
Download sequence
Identical sequences A0A024WF15 A0A024WX68 A0A024XEL2 A0A0L7K6U0 A0A0L7LWW3 A0A2I0BV63 O76245 Q7KWJ3 W4IQA2 W4J6T0 W7G560 W7JWC3
XP_001349579.1.26446 gi|124800999|ref|XP_001349579.1| gi|3845149|gb|AAC71850.1| PFDG_00056T0 PFHG_00789T0 PFB0305c.1 5833.PFB0305c-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]