SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|3845150|gb|AAC71851.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|3845150|gb|AAC71851.1|
Domain Number 1 Region: 207-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000387
Family EGF-type module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|3845150|gb|AAC71851.1|
Sequence length 272
Comment merozoite surface protein 4 [Plasmodium falciparum 3D7]
Sequence
MWIVKFLIVVHFFIICTINFDKLYISYSYNIVPENGRMLNMRILGEEKPNVDGVSTSNTP
GGNESSSASPNLSDAAEKKDEKEASEQGEESHKKENSQESANGKDDVKEEKKTNEKKDDG
KTDKVQEKVLEKSPKESQMVDDKKKTEAIPKKVVQPSSSNSGGHVGEEEDHNEGEGEHEE
EEEHEEDDDDEDDDTYNKDDLEDEDLCKHNNGGCGDDKLCEYVGNRRVKCKCKEGYKLEG
IECVELLSLASSSLNLIFNSFITIFVVILLIN
Download sequence
Identical sequences A0A024VCW7 A0A0L7K6K8 O76244 Q7KWJ2 Q8T7T5 Q8T7T9 Q8T7U3 Q8T7U6 Q8T7U7 W4INS6 W7KDD0
5833.PFB0310c-1 PFHG_00790T0 gi|124801002|ref|XP_001349580.1| gi|3845150|gb|AAC71851.1| PFB0310c XP_001349580.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]