SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46361156|emb|CAG25020.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46361156|emb|CAG25020.1|
Domain Number 1 Region: 461-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family Merozoite surface protein 1 (MSP-1) 0.031
Further Details:      
 
Domain Number 2 Region: 415-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000135
Family Follistatin (FS) module N-terminal domain, FS-N 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46361156|emb|CAG25020.1|
Sequence length 525
Comment Merozoite surface protein 10, MSP10 [Plasmodium falciparum 3D7]
Sequence
MMFFKCNQVFTLVFLLLLYFNNIVYTHVDDIKNTSQKKITYDKYNKNKENMNNEKNDNKD
NKDNIYNDNINNDNINNDNINNEDEYKFLSMKHYKDSLSNKLNNENDHMNYLIRKRKDNT
QGSQHFNENIENNENVENNENIENNENNENIENIENNENNENNENIENNENNENNENSSI
MNSESYNNIINSNEHNEEQIKKKEEDLIEAFFPFILKKLDNESLSLDNKYDDYYNLPNDH
NDTHKENSSDHNLLGYKLGNNLKSYLIEENDVSQKKTDDINESASSDSENIQEILSTDSN
TSHLKERKNQKAPPGEHKPEVKNALLNSQVASPKGEDEKKSQPQHPLVNSGDQLQHPKEI
DENAEKIRRTLLKESRDIKNTTAIIDETVYKFEQLIMKGRYYATAVRNFVIFKVNYICEY
SKCGPNSRCYIVEKDKEQCRCRPNYIVDMSVNYFKCIPMKDMNCSKNNGGCDVNAECTIV
EGAVKCQCSHLYFGDGVFCVKNSQTKQTLYILFIVILLVFQNFFI
Download sequence
Identical sequences C5HDV7 C6KT44 W7K9J2
XP_966190.1.26446 5833.PFF0995c-1 PFF0995c gi|46361156|emb|CAG25020.1| gi|86171334|ref|XP_966190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]