SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46362301|emb|CAG25239.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46362301|emb|CAG25239.1|
Domain Number 1 Region: 116-213
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-30
Family Thioltransferase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46362301|emb|CAG25239.1|
Sequence length 219
Comment glutaredoxin-like protein, putative [Plasmodium falciparum 3D7]
Sequence
MDFIKVEDQRKYIEGNKGYQLFYLNSSTSKEYGSHIDVLNMMLEDYSSVLKIYVINVVDD
NNKYEFQFYAKSQLIKSFVNTNIGSITSFLRKYMQTLSYEQDTEEKNKEKEREKQIIERI
QNLLKNNKIILFMKGTKTFPQCKFSNAVIFMLNSMKIKYETYNILEDQDIRAHLKIYSNW
PTYPQLYINTELIGGHDIIKSMYDNNELALIIPDDCFEE
Download sequence
Identical sequences C6KSR7 W7K9W4
XP_966059.1.26446 5833.PFF0340c-1 PFF0340c gi|46362301|emb|CAG25239.1| gi|86170662|ref|XP_966059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]